Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6A6YJ21

Protein Details
Accession A0A6A6YJ21    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
97-126MANKIEKASRQQRKQRKNRGKTMRGTAKTKHydrophilic
NLS Segment(s)
PositionSequence
102-130EKASRQQRKQRKNRGKTMRGTAKTKGASK
Subcellular Location(s) mito 18, nucl 5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MSDSQVTLRTRKFIRNPLLGRRQMVVDVLHPNRANVSKDELRTKLAELYKAKKDEISVFGFRTQYGGGKSTGFALIYESNEAMKKFEPHYRLVRVGMANKIEKASRQQRKQRKNRGKTMRGTAKTKGASK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.64
3 0.68
4 0.71
5 0.77
6 0.72
7 0.66
8 0.58
9 0.5
10 0.41
11 0.37
12 0.27
13 0.21
14 0.25
15 0.24
16 0.28
17 0.27
18 0.26
19 0.27
20 0.3
21 0.29
22 0.22
23 0.29
24 0.28
25 0.31
26 0.36
27 0.34
28 0.34
29 0.32
30 0.31
31 0.3
32 0.27
33 0.3
34 0.29
35 0.33
36 0.37
37 0.37
38 0.37
39 0.31
40 0.31
41 0.28
42 0.28
43 0.27
44 0.23
45 0.22
46 0.23
47 0.23
48 0.21
49 0.19
50 0.15
51 0.12
52 0.11
53 0.11
54 0.1
55 0.1
56 0.1
57 0.1
58 0.1
59 0.09
60 0.08
61 0.08
62 0.09
63 0.09
64 0.1
65 0.09
66 0.09
67 0.11
68 0.11
69 0.1
70 0.1
71 0.13
72 0.15
73 0.2
74 0.22
75 0.26
76 0.33
77 0.36
78 0.37
79 0.35
80 0.37
81 0.34
82 0.34
83 0.33
84 0.31
85 0.28
86 0.27
87 0.27
88 0.24
89 0.23
90 0.29
91 0.36
92 0.42
93 0.5
94 0.6
95 0.69
96 0.79
97 0.88
98 0.91
99 0.91
100 0.92
101 0.92
102 0.93
103 0.92
104 0.89
105 0.89
106 0.88
107 0.84
108 0.79
109 0.73
110 0.71