Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A6A6Z1V7

Protein Details
Accession A0A6A6Z1V7    Localization Confidence High Confidence Score 17
NoLS Segment(s)
PositionSequenceProtein Nature
8-45QIQKNHFHKDWQRRVRCHFDQPGRKLRRRNARVAKAAAHydrophilic
NLS Segment(s)
PositionSequence
30-45GRKLRRRNARVAKAAA
198-214RAKRAQAKADEKESAKK
Subcellular Location(s) nucl 19, cyto 5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001380  Ribosomal_L13e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01294  Ribosomal_L13e  
Amino Acid Sequences MAIKHNQQIQKNHFHKDWQRRVRCHFDQPGRKLRRRNARVAKAAAVAPRPVDKLRPVVRCPTIKYNRRVRAGRGFTLAELKAAAIPRKLAPTIGISVDPRRQNISEESLKANVERLQEYKKRLILFPRRHGKTKTGDASAEDVKAAKKGDTLSSIASVLPIKNVIEFTEAKIGSVEKTESPYKTLRAARSEARLVGVRAKRAQAKADEKESAKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.67
3 0.69
4 0.73
5 0.72
6 0.77
7 0.78
8 0.84
9 0.85
10 0.81
11 0.8
12 0.79
13 0.78
14 0.79
15 0.79
16 0.82
17 0.82
18 0.82
19 0.81
20 0.8
21 0.81
22 0.78
23 0.8
24 0.8
25 0.8
26 0.81
27 0.76
28 0.7
29 0.61
30 0.56
31 0.48
32 0.4
33 0.31
34 0.25
35 0.23
36 0.23
37 0.21
38 0.22
39 0.22
40 0.29
41 0.35
42 0.4
43 0.41
44 0.46
45 0.51
46 0.52
47 0.54
48 0.56
49 0.58
50 0.6
51 0.66
52 0.69
53 0.7
54 0.74
55 0.72
56 0.67
57 0.67
58 0.65
59 0.58
60 0.51
61 0.44
62 0.36
63 0.38
64 0.31
65 0.21
66 0.15
67 0.13
68 0.11
69 0.13
70 0.13
71 0.1
72 0.11
73 0.12
74 0.14
75 0.14
76 0.12
77 0.12
78 0.12
79 0.13
80 0.13
81 0.13
82 0.12
83 0.14
84 0.2
85 0.2
86 0.19
87 0.2
88 0.19
89 0.2
90 0.22
91 0.25
92 0.22
93 0.23
94 0.23
95 0.22
96 0.22
97 0.19
98 0.19
99 0.15
100 0.14
101 0.14
102 0.15
103 0.2
104 0.24
105 0.28
106 0.31
107 0.31
108 0.31
109 0.32
110 0.39
111 0.43
112 0.48
113 0.54
114 0.59
115 0.6
116 0.64
117 0.64
118 0.61
119 0.57
120 0.57
121 0.52
122 0.45
123 0.41
124 0.38
125 0.39
126 0.34
127 0.27
128 0.19
129 0.15
130 0.13
131 0.14
132 0.13
133 0.1
134 0.1
135 0.12
136 0.14
137 0.16
138 0.17
139 0.16
140 0.16
141 0.16
142 0.14
143 0.14
144 0.13
145 0.1
146 0.1
147 0.1
148 0.09
149 0.09
150 0.1
151 0.1
152 0.12
153 0.13
154 0.14
155 0.21
156 0.21
157 0.2
158 0.2
159 0.2
160 0.17
161 0.18
162 0.18
163 0.11
164 0.16
165 0.21
166 0.21
167 0.24
168 0.27
169 0.27
170 0.33
171 0.38
172 0.39
173 0.4
174 0.44
175 0.46
176 0.49
177 0.5
178 0.43
179 0.4
180 0.38
181 0.34
182 0.38
183 0.37
184 0.36
185 0.37
186 0.42
187 0.46
188 0.46
189 0.51
190 0.51
191 0.57
192 0.58
193 0.6
194 0.61