Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4PEW7

Protein Details
Accession F4PEW7   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
33-61AVKTTKIYCRPSCRSRKPKKINVEFYHNIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 12.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR035451  Ada-like_dom_sf  
IPR004026  Ada_DNA_repair_Zn-bd  
IPR009057  Homeobox-like_sf  
IPR018060  HTH_AraC  
IPR016220  Me-P-triester_DNA_alkyl-Trfase  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
GO:0008168  F:methyltransferase activity  
GO:0043565  F:sequence-specific DNA binding  
GO:0008270  F:zinc ion binding  
GO:0006281  P:DNA repair  
GO:0032259  P:methylation  
Pfam View protein in Pfam  
PF02805  Ada_Zn_binding  
PF12833  HTH_18  
PROSITE View protein in PROSITE  
PS01124  HTH_ARAC_FAMILY_2  
Amino Acid Sequences MWSVVANINLSFEEMWDRIIACDRKYDGLFFTAVKTTKIYCRPSCRSRKPKKINVEFYHNIETVEGAGFRPCKRCKPEIGQSPQVEIVRDTITFLVNHYKQCLTLKDIANQVGLSPFYLERLFKQETSETPRAYLEKIRIDKAAHLLKCTTMTNLEICYEVGFQSPSNFYKVFRDLKNCSPSEYRKELQNELG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.12
4 0.13
5 0.12
6 0.21
7 0.23
8 0.2
9 0.26
10 0.27
11 0.3
12 0.31
13 0.32
14 0.25
15 0.24
16 0.24
17 0.19
18 0.19
19 0.2
20 0.19
21 0.19
22 0.19
23 0.19
24 0.25
25 0.33
26 0.38
27 0.41
28 0.5
29 0.57
30 0.66
31 0.74
32 0.78
33 0.82
34 0.85
35 0.89
36 0.9
37 0.91
38 0.92
39 0.91
40 0.91
41 0.85
42 0.83
43 0.75
44 0.69
45 0.65
46 0.53
47 0.43
48 0.32
49 0.27
50 0.18
51 0.15
52 0.11
53 0.06
54 0.08
55 0.1
56 0.12
57 0.19
58 0.21
59 0.29
60 0.35
61 0.39
62 0.44
63 0.5
64 0.58
65 0.6
66 0.64
67 0.65
68 0.59
69 0.57
70 0.53
71 0.45
72 0.35
73 0.26
74 0.2
75 0.13
76 0.12
77 0.11
78 0.08
79 0.09
80 0.08
81 0.09
82 0.14
83 0.14
84 0.15
85 0.16
86 0.16
87 0.16
88 0.18
89 0.19
90 0.16
91 0.22
92 0.23
93 0.25
94 0.27
95 0.26
96 0.25
97 0.23
98 0.19
99 0.14
100 0.12
101 0.08
102 0.07
103 0.06
104 0.07
105 0.09
106 0.09
107 0.09
108 0.15
109 0.17
110 0.16
111 0.19
112 0.19
113 0.22
114 0.31
115 0.34
116 0.29
117 0.28
118 0.29
119 0.28
120 0.28
121 0.28
122 0.24
123 0.28
124 0.3
125 0.31
126 0.32
127 0.32
128 0.32
129 0.36
130 0.39
131 0.31
132 0.3
133 0.29
134 0.28
135 0.29
136 0.28
137 0.22
138 0.15
139 0.16
140 0.16
141 0.16
142 0.16
143 0.14
144 0.13
145 0.13
146 0.11
147 0.1
148 0.1
149 0.1
150 0.1
151 0.12
152 0.16
153 0.16
154 0.2
155 0.2
156 0.2
157 0.25
158 0.32
159 0.37
160 0.38
161 0.45
162 0.46
163 0.55
164 0.63
165 0.57
166 0.56
167 0.57
168 0.58
169 0.59
170 0.61
171 0.54
172 0.54
173 0.59