Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A6A6YQV5

Protein Details
Accession A0A6A6YQV5    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
12-43IEICRRKDAKTARIKKNKKSNQVKFKVRCSRYHydrophilic
NLS Segment(s)
PositionSequence
17-31RKDAKTARIKKNKKS
73-81KKNPKGKRA
Subcellular Location(s) nucl 12.5, cyto_nucl 9.5, mito 9, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPSEISDLKQFIEICRRKDAKTARIKKNKKSNQVKFKVRCSRYLYTHVVKDAGRAEKLKQSFPPGLLVTEVAKKNPKGKRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.43
3 0.45
4 0.42
5 0.5
6 0.55
7 0.54
8 0.6
9 0.67
10 0.68
11 0.76
12 0.83
13 0.83
14 0.86
15 0.85
16 0.85
17 0.86
18 0.85
19 0.85
20 0.87
21 0.88
22 0.82
23 0.83
24 0.83
25 0.73
26 0.7
27 0.66
28 0.61
29 0.55
30 0.56
31 0.52
32 0.45
33 0.45
34 0.39
35 0.34
36 0.29
37 0.27
38 0.25
39 0.23
40 0.21
41 0.21
42 0.22
43 0.27
44 0.29
45 0.3
46 0.28
47 0.31
48 0.32
49 0.32
50 0.35
51 0.29
52 0.28
53 0.25
54 0.23
55 0.19
56 0.24
57 0.24
58 0.23
59 0.28
60 0.31
61 0.39