Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6A6Y5E0

Protein Details
Accession A0A6A6Y5E0    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MAPKSKTTPKKNKYSILLPTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, cyto 6.5, cyto_pero 5.5, pero 3.5, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR039528  DPM1-like  
IPR001173  Glyco_trans_2-like  
IPR029044  Nucleotide-diphossugar_trans  
Gene Ontology GO:0005783  C:endoplasmic reticulum  
GO:0004582  F:dolichyl-phosphate beta-D-mannosyltransferase activity  
GO:0006486  P:protein glycosylation  
Pfam View protein in Pfam  
PF00535  Glycos_transf_2  
CDD cd06442  DPM1_like  
Amino Acid Sequences MAPKSKTTPKKNKYSILLPTYNERRNLPIITWLLNRTFTENNIDWELIIVDDGSPDGTQEIALQLQKAYPNRIQLRARAGKLGLGTAYVHGLQYATGNFVVIMDADFSHHPKFLPEMIAKQKEGDYDIVTGTRYAGNGGVYGWDLKRKFVSRGANLFADTVLRPGVSDLTGSFRLYKKEVLQRVIGSTESKGYTFQMEMMVRAKGMGCSVAEVPISFVDRVYGESKLGGDEIVEYAKGVLNLWLKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.79
3 0.76
4 0.72
5 0.62
6 0.63
7 0.64
8 0.62
9 0.57
10 0.49
11 0.45
12 0.44
13 0.44
14 0.36
15 0.35
16 0.32
17 0.33
18 0.34
19 0.32
20 0.3
21 0.31
22 0.3
23 0.27
24 0.26
25 0.23
26 0.28
27 0.27
28 0.28
29 0.28
30 0.27
31 0.22
32 0.21
33 0.2
34 0.12
35 0.11
36 0.07
37 0.04
38 0.05
39 0.05
40 0.05
41 0.04
42 0.05
43 0.05
44 0.05
45 0.05
46 0.05
47 0.06
48 0.07
49 0.08
50 0.08
51 0.08
52 0.1
53 0.14
54 0.16
55 0.2
56 0.21
57 0.3
58 0.33
59 0.4
60 0.41
61 0.41
62 0.49
63 0.5
64 0.49
65 0.42
66 0.39
67 0.33
68 0.31
69 0.27
70 0.17
71 0.11
72 0.11
73 0.08
74 0.09
75 0.07
76 0.07
77 0.06
78 0.06
79 0.05
80 0.06
81 0.06
82 0.06
83 0.06
84 0.06
85 0.06
86 0.06
87 0.06
88 0.04
89 0.04
90 0.03
91 0.04
92 0.05
93 0.06
94 0.08
95 0.08
96 0.09
97 0.09
98 0.09
99 0.11
100 0.11
101 0.14
102 0.13
103 0.18
104 0.24
105 0.27
106 0.26
107 0.25
108 0.25
109 0.21
110 0.22
111 0.18
112 0.12
113 0.1
114 0.1
115 0.1
116 0.09
117 0.08
118 0.08
119 0.07
120 0.06
121 0.06
122 0.06
123 0.06
124 0.06
125 0.06
126 0.05
127 0.05
128 0.07
129 0.06
130 0.11
131 0.11
132 0.12
133 0.16
134 0.18
135 0.21
136 0.26
137 0.34
138 0.34
139 0.38
140 0.4
141 0.37
142 0.36
143 0.33
144 0.26
145 0.2
146 0.14
147 0.1
148 0.08
149 0.06
150 0.06
151 0.06
152 0.07
153 0.06
154 0.06
155 0.06
156 0.11
157 0.12
158 0.13
159 0.15
160 0.16
161 0.19
162 0.2
163 0.23
164 0.25
165 0.33
166 0.38
167 0.38
168 0.4
169 0.38
170 0.38
171 0.36
172 0.31
173 0.23
174 0.19
175 0.19
176 0.16
177 0.15
178 0.14
179 0.14
180 0.15
181 0.14
182 0.14
183 0.16
184 0.15
185 0.17
186 0.18
187 0.17
188 0.15
189 0.15
190 0.15
191 0.1
192 0.1
193 0.1
194 0.08
195 0.1
196 0.11
197 0.12
198 0.12
199 0.11
200 0.12
201 0.12
202 0.15
203 0.12
204 0.11
205 0.11
206 0.11
207 0.15
208 0.15
209 0.15
210 0.13
211 0.14
212 0.14
213 0.14
214 0.14
215 0.1
216 0.08
217 0.08
218 0.09
219 0.09
220 0.09
221 0.08
222 0.09
223 0.1
224 0.1
225 0.1
226 0.14