Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A6A6Y2H5

Protein Details
Accession A0A6A6Y2H5    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
104-140QPRPSDGHWRHRLRRKQHLHPRRLHLHRPSPRCRPIRBasic
NLS Segment(s)
PositionSequence
112-135WRHRLRRKQHLHPRRLHLHRPSPR
Subcellular Location(s) nucl 18, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
Amino Acid Sequences MTAEDFVEWFFILWHCSTPKGGKSLNYHRITDNFDIGNRRRRGIATLVWPKPSRVPMRRSTLFASSSEVPAGLSSSLGPWPALPWRERRWRRLLLQEFRLLLAQPRPSDGHWRHRLRRKQHLHPRRLHLHRPSPRCRPIRGEDLAKARLPQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.15
4 0.19
5 0.23
6 0.26
7 0.29
8 0.31
9 0.35
10 0.42
11 0.51
12 0.58
13 0.57
14 0.55
15 0.52
16 0.53
17 0.52
18 0.46
19 0.39
20 0.3
21 0.29
22 0.34
23 0.36
24 0.42
25 0.38
26 0.36
27 0.34
28 0.34
29 0.35
30 0.32
31 0.33
32 0.33
33 0.4
34 0.42
35 0.45
36 0.45
37 0.42
38 0.41
39 0.43
40 0.43
41 0.4
42 0.44
43 0.47
44 0.55
45 0.56
46 0.55
47 0.51
48 0.46
49 0.4
50 0.34
51 0.31
52 0.23
53 0.21
54 0.18
55 0.15
56 0.11
57 0.09
58 0.09
59 0.05
60 0.04
61 0.04
62 0.04
63 0.05
64 0.05
65 0.05
66 0.04
67 0.05
68 0.08
69 0.11
70 0.12
71 0.18
72 0.25
73 0.36
74 0.41
75 0.47
76 0.52
77 0.57
78 0.6
79 0.65
80 0.67
81 0.63
82 0.63
83 0.6
84 0.52
85 0.46
86 0.42
87 0.31
88 0.24
89 0.21
90 0.21
91 0.17
92 0.19
93 0.2
94 0.21
95 0.31
96 0.34
97 0.41
98 0.47
99 0.56
100 0.62
101 0.71
102 0.79
103 0.78
104 0.83
105 0.82
106 0.83
107 0.86
108 0.87
109 0.87
110 0.87
111 0.87
112 0.86
113 0.85
114 0.83
115 0.81
116 0.82
117 0.81
118 0.82
119 0.81
120 0.81
121 0.83
122 0.79
123 0.75
124 0.73
125 0.7
126 0.7
127 0.68
128 0.65
129 0.62
130 0.63
131 0.62