Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6A6YKR6

Protein Details
Accession A0A6A6YKR6    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
67-107ITVIKKPYKPAKYCNRCKGGDQTAVCTCRPQRRWRRFLCGMHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, mito 10, cyto_nucl 8, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MTHHSSISHFGGHHSHHTFHHQPSHHGHHAHHHHHGHHNHHHHQNQPTTVLPYPIVLPQWQPPSTPITVIKKPYKPAKYCNRCKGGDQTAVCTCRPQRRWRRFLCGM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.3
3 0.29
4 0.37
5 0.4
6 0.4
7 0.46
8 0.4
9 0.42
10 0.47
11 0.54
12 0.51
13 0.48
14 0.45
15 0.46
16 0.53
17 0.52
18 0.53
19 0.48
20 0.46
21 0.52
22 0.57
23 0.55
24 0.55
25 0.58
26 0.57
27 0.62
28 0.62
29 0.59
30 0.59
31 0.56
32 0.48
33 0.42
34 0.36
35 0.31
36 0.28
37 0.22
38 0.17
39 0.13
40 0.12
41 0.11
42 0.11
43 0.08
44 0.09
45 0.13
46 0.18
47 0.18
48 0.17
49 0.18
50 0.21
51 0.21
52 0.22
53 0.23
54 0.24
55 0.28
56 0.35
57 0.41
58 0.4
59 0.47
60 0.54
61 0.58
62 0.56
63 0.62
64 0.66
65 0.7
66 0.77
67 0.8
68 0.78
69 0.71
70 0.7
71 0.7
72 0.66
73 0.63
74 0.54
75 0.5
76 0.5
77 0.5
78 0.46
79 0.43
80 0.41
81 0.43
82 0.49
83 0.54
84 0.58
85 0.67
86 0.78
87 0.8