Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6A6Y3V0

Protein Details
Accession A0A6A6Y3V0    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
15-41LLWKMPWRLSRHQKYRHRERLRRVDDIHydrophilic
77-103KYTIFDRKVKRYRKGIHKLPKWTRLSQHydrophilic
NLS Segment(s)
PositionSequence
84-96KVKRYRKGIHKLP
Subcellular Location(s) mito 22, mito_nucl 13.833, cyto_mito 11.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGPFRLTSPLSGGLLWKMPWRLSRHQKYRHRERLRRVDDIISTLDMALAKQGLSTKKLEVWKKDMPTEAEMLPRDKYTIFDRKVKRYRKGIHKLPKWTRLSQRINPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.18
4 0.18
5 0.17
6 0.19
7 0.25
8 0.31
9 0.39
10 0.48
11 0.58
12 0.64
13 0.72
14 0.79
15 0.84
16 0.89
17 0.9
18 0.9
19 0.87
20 0.88
21 0.89
22 0.85
23 0.79
24 0.7
25 0.62
26 0.52
27 0.46
28 0.37
29 0.25
30 0.19
31 0.14
32 0.12
33 0.09
34 0.08
35 0.06
36 0.05
37 0.04
38 0.04
39 0.07
40 0.08
41 0.1
42 0.11
43 0.12
44 0.16
45 0.23
46 0.26
47 0.27
48 0.33
49 0.37
50 0.38
51 0.4
52 0.38
53 0.35
54 0.32
55 0.31
56 0.25
57 0.24
58 0.22
59 0.22
60 0.2
61 0.18
62 0.17
63 0.14
64 0.16
65 0.19
66 0.27
67 0.29
68 0.37
69 0.43
70 0.53
71 0.62
72 0.69
73 0.71
74 0.71
75 0.77
76 0.8
77 0.84
78 0.84
79 0.85
80 0.85
81 0.88
82 0.87
83 0.87
84 0.82
85 0.8
86 0.8
87 0.79
88 0.8
89 0.77
90 0.79