Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6A6YYE6

Protein Details
Accession A0A6A6YYE6    Localization Confidence High Confidence Score 18.2
NoLS Segment(s)
PositionSequenceProtein Nature
22-44RSEPEKSTQSRRKPKPVARIKTTHydrophilic
52-71QEKPTQSRRKPKPVARIKTTHydrophilic
79-98QEKPTQSRRKPKPVARIKTTHydrophilic
NLS Segment(s)
PositionSequence
31-96SRRKPKPVARIKTTQKSPRSEQEKPTQSRRKPKPVARIKTTQKSPRSEQEKPTQSRRKPKPVARIK
Subcellular Location(s) nucl 21.5, cyto_nucl 15.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MCGTPVEEAISPLKSEDLESPRSEPEKSTQSRRKPKPVARIKTTQKSPRSEQEKPTQSRRKPKPVARIKTTQKSPRSEQEKPTQSRRKPKPVARIKTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.18
4 0.2
5 0.23
6 0.24
7 0.26
8 0.29
9 0.31
10 0.3
11 0.25
12 0.26
13 0.32
14 0.34
15 0.43
16 0.48
17 0.56
18 0.66
19 0.72
20 0.78
21 0.78
22 0.81
23 0.82
24 0.83
25 0.82
26 0.77
27 0.78
28 0.76
29 0.74
30 0.75
31 0.72
32 0.68
33 0.64
34 0.62
35 0.62
36 0.62
37 0.57
38 0.55
39 0.56
40 0.59
41 0.58
42 0.64
43 0.65
44 0.64
45 0.7
46 0.74
47 0.75
48 0.75
49 0.78
50 0.79
51 0.8
52 0.82
53 0.77
54 0.78
55 0.75
56 0.74
57 0.75
58 0.72
59 0.68
60 0.64
61 0.62
62 0.62
63 0.62
64 0.57
65 0.55
66 0.56
67 0.59
68 0.58
69 0.64
70 0.65
71 0.64
72 0.7
73 0.74
74 0.75
75 0.75
76 0.78
77 0.79
78 0.8