Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6A6YNX8

Protein Details
Accession A0A6A6YNX8    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
83-115RTAVKAREKSKKKASGDKKRRRKYRALAGEKGEBasic
NLS Segment(s)
PositionSequence
85-117AVKAREKSKKKASGDKKRRRKYRALAGEKGEGK
Subcellular Location(s) nucl 20.5, cyto_nucl 14.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000352  Pep_chain_release_fac_I  
IPR045853  Pep_chain_release_fac_I_sf  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003747  F:translation release factor activity  
Pfam View protein in Pfam  
PF00472  RF-1  
Amino Acid Sequences LPSKPLPPRLVIPENDIIENFLKGSGPGGQKINKTSSAVQLKHIPTGIVIKCQDTRSRSQNRKVARRLLSEKIEELELGEGARTAVKAREKSKKKASGDKKRRRKYRALAGEKGEGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.42
3 0.37
4 0.3
5 0.25
6 0.23
7 0.17
8 0.11
9 0.09
10 0.08
11 0.1
12 0.13
13 0.14
14 0.17
15 0.21
16 0.24
17 0.27
18 0.3
19 0.32
20 0.28
21 0.3
22 0.28
23 0.33
24 0.38
25 0.36
26 0.35
27 0.39
28 0.38
29 0.36
30 0.35
31 0.26
32 0.18
33 0.24
34 0.22
35 0.19
36 0.18
37 0.19
38 0.21
39 0.23
40 0.26
41 0.23
42 0.27
43 0.32
44 0.41
45 0.46
46 0.51
47 0.55
48 0.59
49 0.65
50 0.65
51 0.65
52 0.6
53 0.6
54 0.58
55 0.58
56 0.54
57 0.46
58 0.42
59 0.34
60 0.29
61 0.22
62 0.17
63 0.12
64 0.08
65 0.07
66 0.06
67 0.05
68 0.05
69 0.05
70 0.05
71 0.05
72 0.1
73 0.16
74 0.22
75 0.29
76 0.39
77 0.46
78 0.55
79 0.65
80 0.7
81 0.71
82 0.76
83 0.8
84 0.81
85 0.86
86 0.88
87 0.89
88 0.9
89 0.93
90 0.91
91 0.9
92 0.89
93 0.89
94 0.89
95 0.87
96 0.84
97 0.78