Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6A6Z3D0

Protein Details
Accession A0A6A6Z3D0    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
34-62RRLCIFKGIYPREPRNKKKVSKSSTASTTHydrophilic
629-700NVQPKSKTAEARKKFAKKRREEAEEKERLKMMLPQKKRKLLNRIEYGANKRDKESELLRKKRRKIESVKGGKBasic
NLS Segment(s)
PositionSequence
634-700SKTAEARKKFAKKRREEAEEKERLKMMLPQKKRKLLNRIEYGANKRDKESELLRKKRRKIESVKGGK
Subcellular Location(s) nucl 14, mito 7.5, cyto_mito 7, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001357  BRCT_dom  
IPR036420  BRCT_dom_sf  
IPR010613  PES  
Gene Ontology GO:0005730  C:nucleolus  
GO:0005654  C:nucleoplasm  
GO:0030687  C:preribosome, large subunit precursor  
GO:0043021  F:ribonucleoprotein complex binding  
GO:0000466  P:maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
Pfam View protein in Pfam  
PF06732  Pescadillo_N  
PROSITE View protein in PROSITE  
PS50172  BRCT  
CDD cd17709  BRCT_pescadillo_like  
Amino Acid Sequences MGRIKKKGTAGAAKNFITRTRAVKKLQISLPDFRRLCIFKGIYPREPRNKKKVSKSSTASTTFYYTKDIQYLLHEPLLNKFRDHKALAKKIGRALGRGEAGDAARLEKNLTPKMTLDHIIKERYPTFVDALRDLDDALSMLFLFANLPSTSAVPPKTIALCQRLCLEFEHYLIISHSLKKSFLSIKGIYYQATIQGQDILWLVPYKFVQNITGDIDFRIMGTFVEFYTTLLGFINFRLYTSVGLVYPPKFNAGSDERGGELAAFILEGKGLDSAQTVVNDAVNANGHVPKAITSAAAQAEADKLAELPAPEEETEDSTALVAANGEEESTETIDTFEVTGQDADVLPQPQATGVETSTLFSPFTIYLSRETPRQPLEFLLKAFGCKRVGWDSILGDGAFTTNELDPAITHQIVDRPPLPRESLPAVPDAAPATAGEGADAKPAVGWPRSTVPGRTYVQPQWVWDCVNQGKLQRPDLYSPGATLPPHLSPWVKPKKGQYDPTAPLAEQELEGEAEEFEEEEEQIENGQEAEESEHEKAAPLKLNGKRKSLDVLLDREGSIEPGEGMDVAGSVSESEDEDEGEALTPDEEFDGFSEESESEVSETEEVRLQHQRELEAEARGVPVESLNGNVQPKSKTAEARKKFAKKRREEAEEKERLKMMLPQKKRKLLNRIEYGANKRDKESELLRKKRRKIESVKGGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.56
3 0.5
4 0.43
5 0.39
6 0.39
7 0.4
8 0.47
9 0.48
10 0.53
11 0.57
12 0.62
13 0.63
14 0.63
15 0.6
16 0.62
17 0.63
18 0.65
19 0.59
20 0.51
21 0.54
22 0.47
23 0.45
24 0.45
25 0.41
26 0.36
27 0.47
28 0.53
29 0.55
30 0.61
31 0.68
32 0.7
33 0.78
34 0.82
35 0.82
36 0.86
37 0.86
38 0.88
39 0.89
40 0.86
41 0.86
42 0.83
43 0.8
44 0.78
45 0.73
46 0.64
47 0.55
48 0.52
49 0.44
50 0.39
51 0.36
52 0.3
53 0.28
54 0.28
55 0.27
56 0.23
57 0.26
58 0.29
59 0.27
60 0.29
61 0.28
62 0.26
63 0.33
64 0.39
65 0.34
66 0.32
67 0.36
68 0.37
69 0.42
70 0.45
71 0.46
72 0.5
73 0.58
74 0.66
75 0.65
76 0.64
77 0.62
78 0.65
79 0.58
80 0.5
81 0.44
82 0.4
83 0.36
84 0.32
85 0.27
86 0.23
87 0.21
88 0.21
89 0.18
90 0.15
91 0.14
92 0.15
93 0.16
94 0.16
95 0.23
96 0.26
97 0.27
98 0.26
99 0.26
100 0.29
101 0.31
102 0.33
103 0.29
104 0.31
105 0.34
106 0.36
107 0.36
108 0.39
109 0.36
110 0.34
111 0.34
112 0.28
113 0.26
114 0.27
115 0.28
116 0.24
117 0.25
118 0.24
119 0.22
120 0.2
121 0.17
122 0.12
123 0.1
124 0.08
125 0.06
126 0.04
127 0.04
128 0.04
129 0.04
130 0.04
131 0.04
132 0.07
133 0.07
134 0.08
135 0.09
136 0.11
137 0.12
138 0.16
139 0.17
140 0.15
141 0.16
142 0.18
143 0.19
144 0.21
145 0.25
146 0.28
147 0.28
148 0.29
149 0.33
150 0.31
151 0.3
152 0.29
153 0.29
154 0.22
155 0.22
156 0.22
157 0.17
158 0.17
159 0.16
160 0.18
161 0.15
162 0.17
163 0.19
164 0.19
165 0.19
166 0.19
167 0.23
168 0.25
169 0.27
170 0.29
171 0.28
172 0.29
173 0.33
174 0.33
175 0.29
176 0.25
177 0.21
178 0.18
179 0.18
180 0.16
181 0.13
182 0.13
183 0.13
184 0.13
185 0.13
186 0.09
187 0.09
188 0.09
189 0.09
190 0.1
191 0.1
192 0.11
193 0.12
194 0.12
195 0.14
196 0.14
197 0.16
198 0.17
199 0.18
200 0.17
201 0.15
202 0.15
203 0.13
204 0.12
205 0.1
206 0.07
207 0.05
208 0.06
209 0.06
210 0.05
211 0.07
212 0.07
213 0.07
214 0.09
215 0.09
216 0.08
217 0.08
218 0.09
219 0.07
220 0.07
221 0.11
222 0.09
223 0.09
224 0.1
225 0.11
226 0.11
227 0.12
228 0.12
229 0.08
230 0.1
231 0.12
232 0.12
233 0.14
234 0.13
235 0.14
236 0.13
237 0.13
238 0.18
239 0.19
240 0.22
241 0.21
242 0.22
243 0.2
244 0.2
245 0.2
246 0.14
247 0.09
248 0.06
249 0.04
250 0.03
251 0.03
252 0.03
253 0.03
254 0.03
255 0.03
256 0.04
257 0.04
258 0.04
259 0.04
260 0.05
261 0.07
262 0.07
263 0.07
264 0.07
265 0.08
266 0.08
267 0.07
268 0.07
269 0.06
270 0.06
271 0.06
272 0.07
273 0.07
274 0.07
275 0.07
276 0.07
277 0.08
278 0.08
279 0.07
280 0.06
281 0.09
282 0.09
283 0.09
284 0.09
285 0.08
286 0.08
287 0.08
288 0.07
289 0.05
290 0.04
291 0.04
292 0.05
293 0.05
294 0.05
295 0.06
296 0.07
297 0.07
298 0.07
299 0.07
300 0.08
301 0.09
302 0.09
303 0.08
304 0.07
305 0.07
306 0.06
307 0.06
308 0.04
309 0.03
310 0.03
311 0.03
312 0.03
313 0.03
314 0.03
315 0.04
316 0.04
317 0.04
318 0.04
319 0.05
320 0.05
321 0.05
322 0.05
323 0.05
324 0.04
325 0.05
326 0.05
327 0.04
328 0.05
329 0.05
330 0.05
331 0.06
332 0.06
333 0.06
334 0.06
335 0.06
336 0.06
337 0.06
338 0.06
339 0.05
340 0.05
341 0.07
342 0.07
343 0.07
344 0.08
345 0.08
346 0.07
347 0.06
348 0.07
349 0.06
350 0.07
351 0.08
352 0.08
353 0.1
354 0.12
355 0.13
356 0.15
357 0.17
358 0.19
359 0.21
360 0.21
361 0.2
362 0.2
363 0.23
364 0.22
365 0.21
366 0.2
367 0.17
368 0.18
369 0.18
370 0.2
371 0.17
372 0.15
373 0.18
374 0.19
375 0.2
376 0.19
377 0.2
378 0.17
379 0.16
380 0.17
381 0.14
382 0.09
383 0.08
384 0.07
385 0.05
386 0.05
387 0.05
388 0.04
389 0.05
390 0.05
391 0.05
392 0.05
393 0.08
394 0.1
395 0.09
396 0.09
397 0.09
398 0.13
399 0.14
400 0.16
401 0.16
402 0.16
403 0.18
404 0.2
405 0.22
406 0.19
407 0.22
408 0.23
409 0.24
410 0.22
411 0.22
412 0.21
413 0.18
414 0.19
415 0.16
416 0.11
417 0.08
418 0.07
419 0.07
420 0.07
421 0.06
422 0.06
423 0.06
424 0.06
425 0.07
426 0.07
427 0.06
428 0.05
429 0.06
430 0.09
431 0.09
432 0.1
433 0.11
434 0.14
435 0.18
436 0.2
437 0.21
438 0.2
439 0.26
440 0.27
441 0.28
442 0.3
443 0.29
444 0.34
445 0.33
446 0.33
447 0.29
448 0.29
449 0.27
450 0.23
451 0.26
452 0.21
453 0.23
454 0.24
455 0.24
456 0.3
457 0.33
458 0.36
459 0.34
460 0.35
461 0.35
462 0.35
463 0.35
464 0.27
465 0.25
466 0.23
467 0.21
468 0.18
469 0.17
470 0.17
471 0.14
472 0.15
473 0.16
474 0.16
475 0.17
476 0.28
477 0.36
478 0.36
479 0.39
480 0.47
481 0.55
482 0.62
483 0.66
484 0.62
485 0.61
486 0.62
487 0.63
488 0.56
489 0.45
490 0.38
491 0.33
492 0.26
493 0.17
494 0.14
495 0.1
496 0.08
497 0.08
498 0.08
499 0.06
500 0.06
501 0.05
502 0.05
503 0.04
504 0.05
505 0.05
506 0.05
507 0.06
508 0.05
509 0.06
510 0.06
511 0.06
512 0.05
513 0.05
514 0.05
515 0.05
516 0.07
517 0.07
518 0.1
519 0.11
520 0.11
521 0.11
522 0.13
523 0.14
524 0.16
525 0.21
526 0.2
527 0.28
528 0.35
529 0.45
530 0.48
531 0.52
532 0.49
533 0.46
534 0.49
535 0.43
536 0.43
537 0.38
538 0.39
539 0.37
540 0.36
541 0.34
542 0.3
543 0.27
544 0.21
545 0.16
546 0.11
547 0.08
548 0.07
549 0.07
550 0.06
551 0.06
552 0.05
553 0.04
554 0.04
555 0.04
556 0.03
557 0.03
558 0.04
559 0.04
560 0.05
561 0.06
562 0.06
563 0.06
564 0.07
565 0.07
566 0.07
567 0.07
568 0.07
569 0.06
570 0.06
571 0.06
572 0.05
573 0.06
574 0.06
575 0.05
576 0.06
577 0.1
578 0.1
579 0.1
580 0.12
581 0.11
582 0.12
583 0.12
584 0.12
585 0.08
586 0.08
587 0.09
588 0.08
589 0.09
590 0.1
591 0.13
592 0.13
593 0.17
594 0.24
595 0.25
596 0.27
597 0.29
598 0.29
599 0.27
600 0.33
601 0.31
602 0.26
603 0.25
604 0.22
605 0.21
606 0.19
607 0.18
608 0.12
609 0.1
610 0.09
611 0.09
612 0.11
613 0.12
614 0.16
615 0.18
616 0.2
617 0.23
618 0.23
619 0.24
620 0.27
621 0.3
622 0.34
623 0.43
624 0.53
625 0.56
626 0.64
627 0.72
628 0.78
629 0.83
630 0.83
631 0.83
632 0.82
633 0.86
634 0.86
635 0.86
636 0.83
637 0.83
638 0.84
639 0.84
640 0.76
641 0.7
642 0.62
643 0.52
644 0.47
645 0.45
646 0.44
647 0.44
648 0.52
649 0.59
650 0.67
651 0.76
652 0.82
653 0.84
654 0.84
655 0.85
656 0.85
657 0.83
658 0.78
659 0.77
660 0.77
661 0.75
662 0.73
663 0.7
664 0.62
665 0.55
666 0.56
667 0.5
668 0.49
669 0.51
670 0.54
671 0.57
672 0.66
673 0.74
674 0.78
675 0.85
676 0.88
677 0.88
678 0.87
679 0.87
680 0.87