Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6A6YNK9

Protein Details
Accession A0A6A6YNK9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
9-30SVLRARLPHPHHLRNQRRTFLPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR044996  COQ10-like  
IPR005031  COQ10_START  
IPR023393  START-like_dom_sf  
Gene Ontology GO:0048039  F:ubiquinone binding  
GO:0045333  P:cellular respiration  
GO:0006744  P:ubiquinone biosynthetic process  
Pfam View protein in Pfam  
PF03364  Polyketide_cyc  
Amino Acid Sequences MKPLRPPPSVLRARLPHPHHLRNQRRTFLPNPFTHPSSPLAAAHAKPATLTVSRILPYAHTDLFNLIADVPSYAQFLPYCQSSTVTKWSAEDAHGKRWPSEATLVVGFGGVREGFQSKVYCVAPGAGNTGVGIVEAVSGKSRTRLGAELIRHHLWDSTSKTTPEVVEGDSGLLTHLLTRWTLRPFMFKPPPGKVPGRLLGVFWAEF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.62
3 0.62
4 0.63
5 0.68
6 0.68
7 0.74
8 0.79
9 0.81
10 0.85
11 0.81
12 0.76
13 0.75
14 0.72
15 0.71
16 0.68
17 0.62
18 0.6
19 0.59
20 0.57
21 0.52
22 0.48
23 0.4
24 0.35
25 0.33
26 0.25
27 0.23
28 0.24
29 0.23
30 0.25
31 0.23
32 0.19
33 0.17
34 0.18
35 0.17
36 0.14
37 0.15
38 0.12
39 0.14
40 0.15
41 0.16
42 0.15
43 0.13
44 0.16
45 0.18
46 0.17
47 0.15
48 0.15
49 0.15
50 0.16
51 0.15
52 0.12
53 0.08
54 0.07
55 0.07
56 0.07
57 0.07
58 0.06
59 0.07
60 0.06
61 0.07
62 0.07
63 0.08
64 0.09
65 0.1
66 0.1
67 0.1
68 0.12
69 0.12
70 0.15
71 0.2
72 0.2
73 0.19
74 0.18
75 0.19
76 0.18
77 0.18
78 0.24
79 0.21
80 0.26
81 0.28
82 0.29
83 0.28
84 0.28
85 0.27
86 0.2
87 0.2
88 0.14
89 0.13
90 0.12
91 0.12
92 0.1
93 0.09
94 0.08
95 0.05
96 0.05
97 0.03
98 0.03
99 0.04
100 0.05
101 0.05
102 0.08
103 0.08
104 0.08
105 0.12
106 0.12
107 0.12
108 0.11
109 0.12
110 0.11
111 0.11
112 0.13
113 0.09
114 0.09
115 0.08
116 0.08
117 0.07
118 0.06
119 0.05
120 0.03
121 0.03
122 0.04
123 0.04
124 0.05
125 0.06
126 0.06
127 0.09
128 0.1
129 0.1
130 0.12
131 0.14
132 0.17
133 0.22
134 0.25
135 0.29
136 0.33
137 0.33
138 0.31
139 0.3
140 0.28
141 0.23
142 0.25
143 0.25
144 0.26
145 0.28
146 0.28
147 0.29
148 0.29
149 0.28
150 0.25
151 0.22
152 0.16
153 0.14
154 0.14
155 0.13
156 0.11
157 0.11
158 0.08
159 0.07
160 0.06
161 0.05
162 0.06
163 0.07
164 0.08
165 0.1
166 0.15
167 0.18
168 0.22
169 0.23
170 0.3
171 0.31
172 0.41
173 0.48
174 0.5
175 0.53
176 0.56
177 0.61
178 0.6
179 0.62
180 0.58
181 0.57
182 0.57
183 0.56
184 0.49
185 0.44
186 0.41