Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6A6ZA92

Protein Details
Accession A0A6A6ZA92    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
44-64AVQLHRKRGKRVRDGRLDEKABasic
NLS Segment(s)
PositionSequence
49-56RKRGKRVR
Subcellular Location(s) mito 21, nucl 2, cyto 2, cyto_nucl 2
Family & Domain DBs
Amino Acid Sequences MAARRERASPLLLVHHRATGWRNEDTGAGMAGWRRRLTMAAFFAVQLHRKRGKRVRDGRLDEKAAHSSRVYFIATGQKAKEAEAAMASQTRKRLTSTEIAYGCNDTKISRAAVNGVLDSRNWSSRTLRRTRDPTSKPPEKRHQDSGGHRGGRLPPWSVSDCLVHQRGSPVCTRDGFVPDGSKLYATGYRRHREECPLCGSFWREGGLTRGSLVASGAFRPNV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.34
3 0.31
4 0.32
5 0.33
6 0.32
7 0.33
8 0.31
9 0.3
10 0.29
11 0.29
12 0.28
13 0.25
14 0.17
15 0.12
16 0.11
17 0.14
18 0.16
19 0.2
20 0.18
21 0.18
22 0.18
23 0.2
24 0.22
25 0.26
26 0.26
27 0.24
28 0.24
29 0.23
30 0.24
31 0.25
32 0.28
33 0.24
34 0.28
35 0.35
36 0.37
37 0.47
38 0.53
39 0.61
40 0.66
41 0.74
42 0.76
43 0.78
44 0.83
45 0.81
46 0.79
47 0.72
48 0.62
49 0.55
50 0.52
51 0.42
52 0.36
53 0.29
54 0.23
55 0.21
56 0.22
57 0.2
58 0.13
59 0.14
60 0.2
61 0.21
62 0.22
63 0.21
64 0.22
65 0.22
66 0.22
67 0.23
68 0.15
69 0.14
70 0.12
71 0.12
72 0.1
73 0.12
74 0.13
75 0.12
76 0.14
77 0.15
78 0.15
79 0.16
80 0.17
81 0.18
82 0.24
83 0.24
84 0.28
85 0.28
86 0.28
87 0.27
88 0.27
89 0.23
90 0.17
91 0.15
92 0.09
93 0.09
94 0.09
95 0.1
96 0.09
97 0.09
98 0.1
99 0.12
100 0.12
101 0.11
102 0.1
103 0.09
104 0.08
105 0.11
106 0.11
107 0.11
108 0.12
109 0.14
110 0.18
111 0.23
112 0.32
113 0.37
114 0.41
115 0.46
116 0.52
117 0.57
118 0.62
119 0.63
120 0.64
121 0.66
122 0.71
123 0.7
124 0.73
125 0.76
126 0.75
127 0.75
128 0.72
129 0.7
130 0.68
131 0.68
132 0.67
133 0.64
134 0.56
135 0.51
136 0.46
137 0.41
138 0.38
139 0.33
140 0.28
141 0.21
142 0.25
143 0.27
144 0.25
145 0.24
146 0.22
147 0.21
148 0.24
149 0.25
150 0.21
151 0.19
152 0.24
153 0.24
154 0.25
155 0.27
156 0.24
157 0.25
158 0.25
159 0.26
160 0.23
161 0.25
162 0.25
163 0.22
164 0.22
165 0.2
166 0.21
167 0.2
168 0.17
169 0.14
170 0.14
171 0.18
172 0.18
173 0.25
174 0.32
175 0.39
176 0.43
177 0.47
178 0.48
179 0.54
180 0.57
181 0.55
182 0.54
183 0.48
184 0.45
185 0.45
186 0.45
187 0.36
188 0.32
189 0.28
190 0.2
191 0.2
192 0.23
193 0.22
194 0.19
195 0.17
196 0.17
197 0.15
198 0.15
199 0.14
200 0.13
201 0.11
202 0.13