Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6A6YV30

Protein Details
Accession A0A6A6YV30    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
73-94LCPDPKCKRAKLGKGWPRRDNLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto_nucl 13, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013087  Znf_C2H2_type  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences LRIDAGPVFRCEEPGCHEGFPQKDKLIKHQERHAKPSKCPVPECEYSKTRFALRKDLDRHQRSKHRSHGSELLCPDPKCKRAKLGKGWPRRDNLLRHV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.26
3 0.23
4 0.24
5 0.28
6 0.31
7 0.32
8 0.3
9 0.3
10 0.33
11 0.34
12 0.41
13 0.47
14 0.5
15 0.51
16 0.56
17 0.63
18 0.63
19 0.71
20 0.71
21 0.65
22 0.6
23 0.65
24 0.63
25 0.58
26 0.55
27 0.51
28 0.48
29 0.49
30 0.51
31 0.46
32 0.42
33 0.39
34 0.4
35 0.37
36 0.34
37 0.33
38 0.31
39 0.35
40 0.35
41 0.41
42 0.44
43 0.51
44 0.57
45 0.58
46 0.61
47 0.6
48 0.66
49 0.64
50 0.67
51 0.69
52 0.68
53 0.65
54 0.65
55 0.65
56 0.59
57 0.58
58 0.52
59 0.48
60 0.44
61 0.42
62 0.41
63 0.39
64 0.43
65 0.42
66 0.44
67 0.48
68 0.52
69 0.62
70 0.68
71 0.73
72 0.76
73 0.82
74 0.88
75 0.85
76 0.8
77 0.78
78 0.75