Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A6A6YEB8

Protein Details
Accession A0A6A6YEB8    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
56-87VRTARPRRSEAARPRRRRRLRPQLPKARSRASBasic
91-121LLSRTPTIPRRRRSKTRRLTVRRLRLRKRLEBasic
NLS Segment(s)
PositionSequence
34-119PRPPRPRNPPHRASASLLPPARVRTARPRRSEAARPRRRRRLRPQLPKARSRASMSPLLSRTPTIPRRRRSKTRRLTVRRLRLRKR
Subcellular Location(s) mito 17, nucl 6, cyto 2, plas 2
Family & Domain DBs
Amino Acid Sequences MKLPTRPAMRKALRLLALPRNLLLPPTTLLLPSPRPPRPRNPPHRASASLLPPARVRTARPRRSEAARPRRRRRLRPQLPKARSRASMSPLLSRTPTIPRRRRSKTRRLTVRRLRLRKRLEQSNLTTSTRSAISISISISDDSFFPYYSYSSQNRRMSALPQGLERSSRFFLLFGFLFTPSPLSISAFGWRWHRSSTHIVAAAQSSRLILGYNGMEWGWLRCIEVTAFWEVGNLGGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.57
3 0.55
4 0.53
5 0.47
6 0.41
7 0.35
8 0.33
9 0.29
10 0.24
11 0.17
12 0.14
13 0.15
14 0.15
15 0.13
16 0.14
17 0.18
18 0.21
19 0.26
20 0.34
21 0.39
22 0.47
23 0.52
24 0.62
25 0.68
26 0.75
27 0.79
28 0.8
29 0.8
30 0.79
31 0.8
32 0.73
33 0.67
34 0.63
35 0.56
36 0.54
37 0.48
38 0.42
39 0.37
40 0.36
41 0.35
42 0.3
43 0.29
44 0.33
45 0.43
46 0.5
47 0.54
48 0.59
49 0.59
50 0.65
51 0.7
52 0.7
53 0.71
54 0.73
55 0.77
56 0.81
57 0.87
58 0.9
59 0.91
60 0.91
61 0.91
62 0.92
63 0.92
64 0.93
65 0.93
66 0.9
67 0.87
68 0.82
69 0.76
70 0.68
71 0.62
72 0.55
73 0.48
74 0.47
75 0.41
76 0.4
77 0.36
78 0.33
79 0.29
80 0.25
81 0.23
82 0.25
83 0.32
84 0.37
85 0.44
86 0.51
87 0.6
88 0.68
89 0.77
90 0.78
91 0.81
92 0.81
93 0.83
94 0.87
95 0.85
96 0.87
97 0.86
98 0.87
99 0.86
100 0.86
101 0.83
102 0.81
103 0.79
104 0.77
105 0.74
106 0.72
107 0.67
108 0.64
109 0.6
110 0.57
111 0.54
112 0.46
113 0.4
114 0.31
115 0.27
116 0.21
117 0.17
118 0.11
119 0.08
120 0.08
121 0.09
122 0.09
123 0.08
124 0.09
125 0.08
126 0.08
127 0.08
128 0.07
129 0.09
130 0.09
131 0.08
132 0.08
133 0.08
134 0.09
135 0.11
136 0.16
137 0.18
138 0.23
139 0.32
140 0.36
141 0.36
142 0.38
143 0.37
144 0.34
145 0.38
146 0.37
147 0.28
148 0.26
149 0.27
150 0.26
151 0.27
152 0.25
153 0.23
154 0.19
155 0.19
156 0.18
157 0.16
158 0.15
159 0.17
160 0.16
161 0.13
162 0.13
163 0.12
164 0.12
165 0.12
166 0.13
167 0.09
168 0.1
169 0.09
170 0.1
171 0.1
172 0.11
173 0.15
174 0.16
175 0.18
176 0.23
177 0.25
178 0.25
179 0.26
180 0.26
181 0.28
182 0.34
183 0.36
184 0.37
185 0.37
186 0.35
187 0.34
188 0.36
189 0.31
190 0.24
191 0.2
192 0.14
193 0.11
194 0.11
195 0.1
196 0.07
197 0.09
198 0.09
199 0.1
200 0.1
201 0.1
202 0.1
203 0.1
204 0.12
205 0.12
206 0.11
207 0.12
208 0.11
209 0.13
210 0.13
211 0.15
212 0.16
213 0.17
214 0.17
215 0.15
216 0.16
217 0.14