Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6A6YCN8

Protein Details
Accession A0A6A6YCN8    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
67-88LKAKTVRAINWKRHRNNIYNKIHydrophilic
NLS Segment(s)
PositionSequence
42-80NRLKNKPIKPPGKNWARGFKKRHPELKAKTVRAINWKRH
Subcellular Location(s) mito 12, nucl 10, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR006600  HTH_CenpB_DNA-bd_dom  
Pfam View protein in Pfam  
PF03221  HTH_Tnp_Tc5  
PROSITE View protein in PROSITE  
PS51253  HTH_CENPB  
Amino Acid Sequences SQQYLTPDEEKAVIKFLLLMSNLGQPVRIKFIPSLAFCVARNRLKNKPIKPPGKNWARGFKKRHPELKAKTVRAINWKRHRNNIYNKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.14
4 0.15
5 0.14
6 0.14
7 0.12
8 0.15
9 0.16
10 0.14
11 0.15
12 0.13
13 0.14
14 0.18
15 0.17
16 0.16
17 0.15
18 0.2
19 0.23
20 0.23
21 0.26
22 0.22
23 0.23
24 0.22
25 0.26
26 0.27
27 0.27
28 0.31
29 0.31
30 0.36
31 0.42
32 0.5
33 0.51
34 0.56
35 0.61
36 0.66
37 0.66
38 0.68
39 0.7
40 0.71
41 0.74
42 0.67
43 0.68
44 0.68
45 0.72
46 0.72
47 0.72
48 0.73
49 0.74
50 0.78
51 0.74
52 0.75
53 0.74
54 0.77
55 0.78
56 0.71
57 0.69
58 0.64
59 0.62
60 0.63
61 0.64
62 0.64
63 0.65
64 0.72
65 0.72
66 0.78
67 0.82
68 0.81