Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6A6Y432

Protein Details
Accession A0A6A6Y432    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
150-175KPVVQIKSRNPKKPDRHPSNTNYSKDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 14, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MSSANVSQHQELERRGRHLPAQISEIRRNTKINESHLTEQEADRDPRFAIFISRELSIRRHVQESRSVIRLVRRRTEYGSFRYMRTWLKDHPNFLVLAKIHQSLANFHVTEMIDLRAQLTHILEIGIPLMTEGEVLENLQLAKRMLSYLKPVVQIKSRNPKKPDRHPSNTNYSKDSTTVLDLSPQRAKDGKLVSGMEMASFRTLSSSQKGERERDVDIRLKKFLSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.44
3 0.44
4 0.45
5 0.48
6 0.49
7 0.42
8 0.44
9 0.46
10 0.49
11 0.53
12 0.55
13 0.52
14 0.49
15 0.49
16 0.46
17 0.49
18 0.49
19 0.48
20 0.49
21 0.5
22 0.52
23 0.52
24 0.51
25 0.44
26 0.38
27 0.37
28 0.35
29 0.32
30 0.27
31 0.26
32 0.23
33 0.21
34 0.22
35 0.17
36 0.15
37 0.15
38 0.17
39 0.18
40 0.18
41 0.19
42 0.2
43 0.22
44 0.23
45 0.26
46 0.26
47 0.29
48 0.31
49 0.33
50 0.39
51 0.43
52 0.42
53 0.39
54 0.37
55 0.34
56 0.39
57 0.43
58 0.4
59 0.41
60 0.42
61 0.42
62 0.45
63 0.51
64 0.49
65 0.47
66 0.5
67 0.44
68 0.4
69 0.39
70 0.38
71 0.34
72 0.33
73 0.31
74 0.28
75 0.37
76 0.39
77 0.4
78 0.38
79 0.36
80 0.32
81 0.29
82 0.27
83 0.17
84 0.15
85 0.15
86 0.14
87 0.13
88 0.14
89 0.14
90 0.11
91 0.13
92 0.15
93 0.13
94 0.13
95 0.15
96 0.14
97 0.14
98 0.13
99 0.11
100 0.08
101 0.08
102 0.08
103 0.06
104 0.06
105 0.06
106 0.06
107 0.05
108 0.05
109 0.05
110 0.05
111 0.05
112 0.05
113 0.04
114 0.03
115 0.03
116 0.03
117 0.03
118 0.03
119 0.03
120 0.03
121 0.03
122 0.03
123 0.03
124 0.04
125 0.04
126 0.05
127 0.06
128 0.06
129 0.06
130 0.06
131 0.07
132 0.08
133 0.1
134 0.14
135 0.17
136 0.2
137 0.24
138 0.26
139 0.27
140 0.32
141 0.37
142 0.4
143 0.48
144 0.53
145 0.57
146 0.62
147 0.69
148 0.73
149 0.79
150 0.82
151 0.8
152 0.81
153 0.8
154 0.81
155 0.82
156 0.8
157 0.72
158 0.64
159 0.57
160 0.5
161 0.42
162 0.38
163 0.28
164 0.22
165 0.21
166 0.17
167 0.21
168 0.21
169 0.25
170 0.28
171 0.26
172 0.27
173 0.28
174 0.3
175 0.3
176 0.32
177 0.3
178 0.31
179 0.31
180 0.29
181 0.28
182 0.27
183 0.21
184 0.18
185 0.16
186 0.12
187 0.11
188 0.1
189 0.11
190 0.12
191 0.15
192 0.19
193 0.24
194 0.27
195 0.35
196 0.41
197 0.42
198 0.48
199 0.47
200 0.47
201 0.47
202 0.49
203 0.5
204 0.52
205 0.52
206 0.5