Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6A6Y2S2

Protein Details
Accession A0A6A6Y2S2    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
112-132RTALRRRRRLSMPSRHCHRPABasic
NLS Segment(s)
PositionSequence
116-120RRRRR
Subcellular Location(s) nucl 13.5, mito 13, cyto_nucl 7.5
Family & Domain DBs
Amino Acid Sequences MHGARVCSAFHGSQCRAGSRTFVRTAGGWIRRNHGRTSTAIPHPLLLPSLPSAQPGEAHAPCRRRARTASSFANPALPCMPPPQPPATPSTTPLLAQSTALAPGPGHPRLVRTALRRRRRLSMPSRHCHRPASGRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.35
3 0.33
4 0.32
5 0.35
6 0.32
7 0.37
8 0.32
9 0.31
10 0.29
11 0.28
12 0.32
13 0.34
14 0.37
15 0.37
16 0.36
17 0.41
18 0.46
19 0.48
20 0.46
21 0.43
22 0.38
23 0.35
24 0.4
25 0.41
26 0.38
27 0.39
28 0.36
29 0.32
30 0.3
31 0.27
32 0.21
33 0.14
34 0.11
35 0.09
36 0.12
37 0.11
38 0.11
39 0.11
40 0.11
41 0.11
42 0.12
43 0.16
44 0.14
45 0.17
46 0.2
47 0.23
48 0.28
49 0.35
50 0.35
51 0.33
52 0.35
53 0.41
54 0.44
55 0.47
56 0.47
57 0.41
58 0.42
59 0.38
60 0.4
61 0.31
62 0.26
63 0.2
64 0.15
65 0.14
66 0.16
67 0.18
68 0.16
69 0.19
70 0.23
71 0.23
72 0.24
73 0.27
74 0.3
75 0.29
76 0.28
77 0.27
78 0.24
79 0.23
80 0.23
81 0.21
82 0.15
83 0.14
84 0.13
85 0.1
86 0.1
87 0.1
88 0.09
89 0.07
90 0.11
91 0.16
92 0.16
93 0.18
94 0.17
95 0.19
96 0.23
97 0.28
98 0.3
99 0.34
100 0.44
101 0.52
102 0.62
103 0.69
104 0.7
105 0.73
106 0.75
107 0.77
108 0.76
109 0.77
110 0.78
111 0.79
112 0.82
113 0.82
114 0.78
115 0.72
116 0.69