Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6A6Y1C5

Protein Details
Accession A0A6A6Y1C5    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
52-78DHSARQCPFKTRKQRNRTRQRMNPGTSHydrophilic
NLS Segment(s)
PositionSequence
63-90RKQRNRTRQRMNPGTSRRERDQRRNKER
Subcellular Location(s) nucl 21.5, cyto_nucl 14, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MAAHKPLSSADRKPGDQGQQGPVTSTNTTAVQPVRGLQACGVCRNVRRVFKDHSARQCPFKTRKQRNRTRQRMNPGTSRRERDQRRNKERHAAQSEKEETNDQLQPLHLLPIRAKQPEGSLGEDANDVPHESQDEDNGRVDVGAREEEYKQGVEMAKNYKEQQYQEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.51
3 0.51
4 0.51
5 0.48
6 0.47
7 0.46
8 0.42
9 0.38
10 0.33
11 0.27
12 0.24
13 0.2
14 0.17
15 0.17
16 0.19
17 0.18
18 0.16
19 0.16
20 0.16
21 0.2
22 0.19
23 0.19
24 0.18
25 0.22
26 0.22
27 0.24
28 0.26
29 0.23
30 0.25
31 0.32
32 0.38
33 0.39
34 0.42
35 0.45
36 0.48
37 0.55
38 0.62
39 0.61
40 0.64
41 0.66
42 0.63
43 0.65
44 0.63
45 0.62
46 0.6
47 0.62
48 0.63
49 0.66
50 0.75
51 0.79
52 0.85
53 0.88
54 0.92
55 0.93
56 0.92
57 0.89
58 0.88
59 0.86
60 0.8
61 0.78
62 0.73
63 0.71
64 0.66
65 0.64
66 0.58
67 0.58
68 0.61
69 0.62
70 0.67
71 0.69
72 0.75
73 0.77
74 0.76
75 0.77
76 0.74
77 0.73
78 0.7
79 0.63
80 0.54
81 0.54
82 0.55
83 0.45
84 0.42
85 0.33
86 0.26
87 0.26
88 0.26
89 0.18
90 0.14
91 0.14
92 0.14
93 0.13
94 0.16
95 0.13
96 0.12
97 0.13
98 0.18
99 0.23
100 0.22
101 0.23
102 0.2
103 0.21
104 0.26
105 0.27
106 0.24
107 0.21
108 0.2
109 0.2
110 0.19
111 0.17
112 0.12
113 0.1
114 0.08
115 0.08
116 0.08
117 0.08
118 0.1
119 0.1
120 0.15
121 0.17
122 0.18
123 0.19
124 0.19
125 0.18
126 0.16
127 0.17
128 0.13
129 0.12
130 0.12
131 0.12
132 0.15
133 0.15
134 0.17
135 0.18
136 0.17
137 0.15
138 0.17
139 0.19
140 0.19
141 0.23
142 0.28
143 0.3
144 0.34
145 0.37
146 0.4
147 0.43