Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6A6Z7M8

Protein Details
Accession A0A6A6Z7M8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MPLLKRKAKDKPQKPPKPTKETRLELDBasic
NLS Segment(s)
PositionSequence
5-20KRKAKDKPQKPPKPTK
Subcellular Location(s) plas 8, mito 7, cyto 7, cyto_mito 7
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPLLKRKAKDKPQKPPKPTKETRLELDLRNGRVILTRTPVAVPVPAASVPPPPPPNPTPTLTSPPLPDRGLPPPPYLPQNEEPNPTQPDLALVPVEEANDWLSLGYRMLPAVQAVGTGLVAVAGVIGVWMEMEKERRKGATGGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.92
3 0.92
4 0.91
5 0.89
6 0.87
7 0.86
8 0.81
9 0.76
10 0.72
11 0.66
12 0.58
13 0.6
14 0.56
15 0.47
16 0.43
17 0.38
18 0.3
19 0.3
20 0.29
21 0.22
22 0.21
23 0.2
24 0.19
25 0.2
26 0.2
27 0.17
28 0.15
29 0.13
30 0.09
31 0.1
32 0.09
33 0.09
34 0.09
35 0.11
36 0.12
37 0.17
38 0.2
39 0.19
40 0.25
41 0.26
42 0.31
43 0.31
44 0.32
45 0.31
46 0.31
47 0.36
48 0.32
49 0.32
50 0.29
51 0.28
52 0.29
53 0.25
54 0.22
55 0.2
56 0.22
57 0.26
58 0.26
59 0.25
60 0.24
61 0.25
62 0.27
63 0.25
64 0.25
65 0.25
66 0.31
67 0.31
68 0.32
69 0.32
70 0.34
71 0.35
72 0.3
73 0.26
74 0.18
75 0.18
76 0.15
77 0.14
78 0.09
79 0.07
80 0.07
81 0.08
82 0.08
83 0.06
84 0.06
85 0.06
86 0.06
87 0.06
88 0.05
89 0.06
90 0.06
91 0.06
92 0.07
93 0.06
94 0.06
95 0.06
96 0.07
97 0.06
98 0.07
99 0.06
100 0.05
101 0.05
102 0.05
103 0.05
104 0.04
105 0.04
106 0.03
107 0.03
108 0.03
109 0.02
110 0.02
111 0.02
112 0.02
113 0.02
114 0.02
115 0.02
116 0.02
117 0.04
118 0.06
119 0.13
120 0.19
121 0.23
122 0.26
123 0.28
124 0.31