Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6A6YTS1

Protein Details
Accession A0A6A6YTS1    Localization Confidence High Confidence Score 17.1
NoLS Segment(s)
PositionSequenceProtein Nature
32-53LGKVRVTKAKAKSKERNTRNMQHydrophilic
NLS Segment(s)
PositionSequence
38-47TKAKAKSKER
85-98ETKSRRTKIDRPLR
106-126SKASRFAGIKVKSPSGPRRRG
Subcellular Location(s) nucl 18.5, cyto_nucl 12, mito 6
Family & Domain DBs
Amino Acid Sequences MRIRLPQQRPPEGPPLVNRERRTKQIDGPSVLGKVRVTKAKAKSKERNTRNMQTQKPKAPEPEPSIQKLDVILQSSTSQASKRPETKSRRTKIDRPLRQIHPQSVSKASRFAGIKVKSPSGPRRRGAEQTQSPDRARRPTPQQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.55
3 0.55
4 0.59
5 0.57
6 0.58
7 0.6
8 0.64
9 0.65
10 0.61
11 0.6
12 0.62
13 0.65
14 0.59
15 0.56
16 0.51
17 0.46
18 0.41
19 0.34
20 0.25
21 0.22
22 0.22
23 0.25
24 0.26
25 0.32
26 0.41
27 0.5
28 0.58
29 0.63
30 0.69
31 0.75
32 0.82
33 0.8
34 0.81
35 0.79
36 0.79
37 0.79
38 0.78
39 0.75
40 0.74
41 0.76
42 0.73
43 0.69
44 0.64
45 0.58
46 0.52
47 0.51
48 0.47
49 0.48
50 0.43
51 0.42
52 0.41
53 0.36
54 0.33
55 0.27
56 0.22
57 0.15
58 0.14
59 0.11
60 0.1
61 0.1
62 0.1
63 0.11
64 0.1
65 0.09
66 0.11
67 0.15
68 0.2
69 0.25
70 0.31
71 0.39
72 0.47
73 0.57
74 0.64
75 0.66
76 0.71
77 0.73
78 0.75
79 0.77
80 0.8
81 0.77
82 0.75
83 0.77
84 0.72
85 0.74
86 0.71
87 0.66
88 0.61
89 0.56
90 0.51
91 0.5
92 0.48
93 0.4
94 0.38
95 0.33
96 0.33
97 0.31
98 0.3
99 0.32
100 0.3
101 0.36
102 0.37
103 0.4
104 0.37
105 0.44
106 0.52
107 0.53
108 0.59
109 0.57
110 0.6
111 0.62
112 0.67
113 0.67
114 0.67
115 0.65
116 0.65
117 0.69
118 0.68
119 0.65
120 0.64
121 0.62
122 0.6
123 0.56
124 0.56