Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F4PFL5

Protein Details
Accession F4PFL5    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
3-31GINVNLEQTKKNKKNKKRNRLILRTSILAHydrophilic
NLS Segment(s)
PositionSequence
12-22KKNKKNKKRNR
Subcellular Location(s) mito 7.5, cyto_mito 5.5, plas 5, nucl 4, E.R. 4, pero 3, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000866  AhpC/TSA  
IPR036249  Thioredoxin-like_sf  
IPR013766  Thioredoxin_domain  
Gene Ontology GO:0016020  C:membrane  
GO:0016209  F:antioxidant activity  
GO:0016491  F:oxidoreductase activity  
GO:0034599  P:cellular response to oxidative stress  
Pfam View protein in Pfam  
PF00578  AhpC-TSA  
PROSITE View protein in PROSITE  
PS51352  THIOREDOXIN_2  
CDD cd02966  TlpA_like_family  
Amino Acid Sequences MGGINVNLEQTKKNKKNKKRNRLILRTSILAVLLSAVVFALVSNLRADNTVYQVGDRAPDFKLKQINKNNELEYVQLSDFEGKGVMLNFWGTWCKPCEAEMPYMEALYPEYKEKGIEIIAVSLDNTELAVDGEVRDLYKIGPIPSTVFINPSGEIERTVIGALTLEKLEGYFQEILPQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.72
3 0.82
4 0.89
5 0.92
6 0.92
7 0.94
8 0.95
9 0.95
10 0.92
11 0.9
12 0.83
13 0.74
14 0.64
15 0.53
16 0.42
17 0.31
18 0.22
19 0.13
20 0.08
21 0.06
22 0.04
23 0.04
24 0.03
25 0.03
26 0.03
27 0.04
28 0.04
29 0.05
30 0.06
31 0.07
32 0.07
33 0.08
34 0.09
35 0.09
36 0.12
37 0.13
38 0.12
39 0.12
40 0.13
41 0.12
42 0.13
43 0.12
44 0.11
45 0.1
46 0.16
47 0.16
48 0.19
49 0.28
50 0.3
51 0.39
52 0.46
53 0.54
54 0.54
55 0.57
56 0.54
57 0.48
58 0.44
59 0.36
60 0.28
61 0.21
62 0.16
63 0.12
64 0.11
65 0.1
66 0.09
67 0.08
68 0.07
69 0.05
70 0.05
71 0.05
72 0.05
73 0.04
74 0.05
75 0.04
76 0.05
77 0.06
78 0.06
79 0.07
80 0.09
81 0.1
82 0.1
83 0.11
84 0.15
85 0.16
86 0.19
87 0.18
88 0.2
89 0.19
90 0.19
91 0.17
92 0.13
93 0.12
94 0.1
95 0.1
96 0.08
97 0.09
98 0.09
99 0.09
100 0.09
101 0.09
102 0.09
103 0.09
104 0.08
105 0.08
106 0.08
107 0.08
108 0.07
109 0.06
110 0.06
111 0.04
112 0.04
113 0.03
114 0.03
115 0.03
116 0.04
117 0.04
118 0.04
119 0.05
120 0.06
121 0.06
122 0.06
123 0.06
124 0.06
125 0.09
126 0.11
127 0.11
128 0.12
129 0.13
130 0.15
131 0.17
132 0.2
133 0.17
134 0.16
135 0.17
136 0.18
137 0.17
138 0.17
139 0.17
140 0.15
141 0.15
142 0.15
143 0.14
144 0.13
145 0.12
146 0.1
147 0.08
148 0.08
149 0.08
150 0.08
151 0.08
152 0.08
153 0.07
154 0.08
155 0.08
156 0.08
157 0.12
158 0.12
159 0.12