Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6A6Y9M0

Protein Details
Accession A0A6A6Y9M0    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
39-60AKEAIKGKRGRKRKNPAPAGTKBasic
NLS Segment(s)
PositionSequence
32-66KRAAKDTAKEAIKGKRGRKRKNPAPAGTKAKKARK
Subcellular Location(s) nucl 17.5, cyto_nucl 10, mito 8
Family & Domain DBs
Amino Acid Sequences NNESKCRKLTKSTVVGKAKVMSYEDIVEAQAKRAAKDTAKEAIKGKRGRKRKNPAPAGTKAKKARKSEAEVAADEIAASGMESHCSVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.68
3 0.62
4 0.56
5 0.47
6 0.39
7 0.32
8 0.24
9 0.19
10 0.19
11 0.17
12 0.14
13 0.13
14 0.14
15 0.12
16 0.12
17 0.13
18 0.12
19 0.12
20 0.14
21 0.16
22 0.15
23 0.17
24 0.2
25 0.24
26 0.25
27 0.27
28 0.28
29 0.31
30 0.37
31 0.41
32 0.45
33 0.46
34 0.55
35 0.63
36 0.7
37 0.76
38 0.77
39 0.82
40 0.83
41 0.83
42 0.8
43 0.78
44 0.77
45 0.7
46 0.7
47 0.68
48 0.67
49 0.67
50 0.66
51 0.66
52 0.65
53 0.69
54 0.69
55 0.68
56 0.63
57 0.55
58 0.53
59 0.44
60 0.35
61 0.27
62 0.19
63 0.11
64 0.07
65 0.06
66 0.05
67 0.05
68 0.06