Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6A6Y7I4

Protein Details
Accession A0A6A6Y7I4    Localization Confidence High Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
17-40TDLRRMPRTTKPTQSRLRNRHLISHydrophilic
52-78KTNPTTPRTRDRTRHTRKPNPHRLLAPHydrophilic
NLS Segment(s)
PositionSequence
32-73RLRNRHLISARKPPSPSRLPKTNPTTPRTRDRTRHTRKPNPH
Subcellular Location(s) nucl 19.5, cyto_nucl 11, mito 5
Family & Domain DBs
Amino Acid Sequences MLHQFVVHSSKTTLIETDLRRMPRTTKPTQSRLRNRHLISARKPPSPSRLPKTNPTTPRTRDRTRHTRKPNPHRLLAPEPSPPKSLPTSIETIETYYGLVRRWGDTNLSSTDLMQPLQDPNLLFDPPPKDSYPVNCPTILPKSSFDSTILDVDLAIFDMDPNNSMAHINPTVLDMDPNNLMAHISPTIFDMDPNN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.27
3 0.27
4 0.33
5 0.35
6 0.36
7 0.38
8 0.39
9 0.41
10 0.43
11 0.49
12 0.5
13 0.55
14 0.6
15 0.68
16 0.75
17 0.81
18 0.83
19 0.84
20 0.85
21 0.83
22 0.76
23 0.76
24 0.74
25 0.73
26 0.68
27 0.7
28 0.65
29 0.61
30 0.62
31 0.57
32 0.57
33 0.58
34 0.6
35 0.57
36 0.62
37 0.62
38 0.68
39 0.72
40 0.73
41 0.7
42 0.66
43 0.67
44 0.63
45 0.68
46 0.67
47 0.67
48 0.66
49 0.68
50 0.75
51 0.76
52 0.81
53 0.81
54 0.84
55 0.86
56 0.89
57 0.91
58 0.85
59 0.8
60 0.73
61 0.69
62 0.65
63 0.58
64 0.49
65 0.45
66 0.42
67 0.39
68 0.38
69 0.31
70 0.28
71 0.26
72 0.25
73 0.21
74 0.21
75 0.21
76 0.19
77 0.2
78 0.18
79 0.16
80 0.15
81 0.12
82 0.1
83 0.08
84 0.08
85 0.07
86 0.08
87 0.08
88 0.09
89 0.1
90 0.11
91 0.12
92 0.12
93 0.14
94 0.14
95 0.16
96 0.15
97 0.14
98 0.15
99 0.14
100 0.13
101 0.11
102 0.1
103 0.09
104 0.09
105 0.11
106 0.08
107 0.1
108 0.12
109 0.12
110 0.11
111 0.14
112 0.17
113 0.17
114 0.21
115 0.19
116 0.2
117 0.22
118 0.26
119 0.3
120 0.32
121 0.32
122 0.29
123 0.29
124 0.31
125 0.35
126 0.32
127 0.27
128 0.24
129 0.27
130 0.28
131 0.28
132 0.25
133 0.22
134 0.22
135 0.21
136 0.19
137 0.13
138 0.12
139 0.11
140 0.09
141 0.07
142 0.05
143 0.04
144 0.04
145 0.05
146 0.06
147 0.06
148 0.07
149 0.07
150 0.08
151 0.08
152 0.09
153 0.13
154 0.14
155 0.13
156 0.13
157 0.13
158 0.14
159 0.14
160 0.15
161 0.11
162 0.12
163 0.13
164 0.14
165 0.13
166 0.11
167 0.12
168 0.1
169 0.13
170 0.11
171 0.11
172 0.1
173 0.11
174 0.14
175 0.14