Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6A6YKT2

Protein Details
Accession A0A6A6YKT2    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-23PPYKQCLLKKNKRQQQGKQDYGIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR029035  DHS-like_NAD/FAD-binding_dom  
Amino Acid Sequences PPYKQCLLKKNKRQQQGKQDYGIEYLRPCIVLYNKGSPDAEAIRAIFIKDLRLRPDAIIIAGTLLEIIRVRRIVREIYRVVSDHRNSIIIWINIEPKPVSSKLKSY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.89
3 0.88
4 0.83
5 0.77
6 0.72
7 0.63
8 0.57
9 0.48
10 0.38
11 0.28
12 0.23
13 0.19
14 0.16
15 0.14
16 0.14
17 0.15
18 0.19
19 0.21
20 0.27
21 0.27
22 0.29
23 0.29
24 0.25
25 0.25
26 0.21
27 0.19
28 0.13
29 0.12
30 0.11
31 0.11
32 0.11
33 0.09
34 0.08
35 0.11
36 0.14
37 0.16
38 0.18
39 0.19
40 0.2
41 0.19
42 0.21
43 0.17
44 0.13
45 0.11
46 0.08
47 0.07
48 0.06
49 0.05
50 0.03
51 0.03
52 0.03
53 0.04
54 0.04
55 0.06
56 0.08
57 0.08
58 0.1
59 0.13
60 0.19
61 0.22
62 0.28
63 0.29
64 0.3
65 0.32
66 0.31
67 0.33
68 0.35
69 0.33
70 0.3
71 0.29
72 0.27
73 0.25
74 0.27
75 0.3
76 0.22
77 0.23
78 0.21
79 0.26
80 0.25
81 0.28
82 0.24
83 0.19
84 0.24
85 0.26
86 0.32