Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6A6Z8Y2

Protein Details
Accession A0A6A6Z8Y2    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
46-87KGKEKDPKEKDAKQKDPKEKDGDKKAKEKDPKPKDPKDKDESBasic
NLS Segment(s)
PositionSequence
9-97EGKGKEGKGKGTKDKDGKEKDAKEKNGKEKDGKENGAKGKEKDPKEKDAKQKDPKEKDGDKKAKEKDPKPKDPKDKDESKPKTPPAPKK
Subcellular Location(s) nucl 14.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
Pfam View protein in Pfam  
PF14608  zf-CCCH_2  
Amino Acid Sequences MPKALKNVEGKGKEGKGKGTKDKDGKEKDAKEKNGKEKDGKENGAKGKEKDPKEKDAKQKDPKEKDGDKKAKEKDPKPKDPKDKDESKPKTPPAPKKSQTDCQYGSECTALDCKYKHPQRGPCRYGEDCKNDKCGFEHGARQCKFKVCRKAGCTFKHRAGQRGKVKEST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.51
3 0.5
4 0.55
5 0.62
6 0.62
7 0.66
8 0.68
9 0.73
10 0.75
11 0.74
12 0.75
13 0.74
14 0.74
15 0.75
16 0.76
17 0.77
18 0.77
19 0.78
20 0.8
21 0.79
22 0.76
23 0.74
24 0.72
25 0.73
26 0.71
27 0.67
28 0.61
29 0.59
30 0.59
31 0.59
32 0.56
33 0.48
34 0.49
35 0.53
36 0.54
37 0.57
38 0.56
39 0.58
40 0.63
41 0.68
42 0.7
43 0.72
44 0.77
45 0.77
46 0.82
47 0.83
48 0.81
49 0.8
50 0.78
51 0.75
52 0.73
53 0.74
54 0.73
55 0.68
56 0.69
57 0.68
58 0.67
59 0.69
60 0.67
61 0.67
62 0.68
63 0.74
64 0.75
65 0.79
66 0.81
67 0.8
68 0.81
69 0.78
70 0.77
71 0.72
72 0.74
73 0.7
74 0.67
75 0.65
76 0.59
77 0.61
78 0.6
79 0.65
80 0.62
81 0.66
82 0.64
83 0.67
84 0.7
85 0.7
86 0.67
87 0.63
88 0.58
89 0.51
90 0.48
91 0.4
92 0.35
93 0.27
94 0.22
95 0.15
96 0.16
97 0.13
98 0.13
99 0.14
100 0.17
101 0.26
102 0.33
103 0.4
104 0.45
105 0.55
106 0.62
107 0.73
108 0.72
109 0.67
110 0.68
111 0.64
112 0.64
113 0.62
114 0.6
115 0.56
116 0.56
117 0.58
118 0.52
119 0.49
120 0.44
121 0.4
122 0.35
123 0.32
124 0.38
125 0.38
126 0.47
127 0.47
128 0.49
129 0.47
130 0.52
131 0.56
132 0.57
133 0.6
134 0.59
135 0.67
136 0.69
137 0.76
138 0.76
139 0.77
140 0.75
141 0.72
142 0.71
143 0.7
144 0.68
145 0.68
146 0.68
147 0.69
148 0.72
149 0.74