Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6A6YFB1

Protein Details
Accession A0A6A6YFB1    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
36-58ITDGTQKSKKSRKQDGDKRDEKABasic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 14, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MPAWNGSISRQIRLCEVCIKVFDGRWPDGRRVQTFITDGTQKSKKSRKQDGDKRDEKARLEDFNRFIESEQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.3
3 0.31
4 0.28
5 0.26
6 0.28
7 0.25
8 0.23
9 0.25
10 0.23
11 0.23
12 0.29
13 0.3
14 0.32
15 0.36
16 0.4
17 0.38
18 0.37
19 0.35
20 0.3
21 0.28
22 0.25
23 0.21
24 0.18
25 0.17
26 0.19
27 0.23
28 0.22
29 0.29
30 0.37
31 0.42
32 0.5
33 0.6
34 0.65
35 0.72
36 0.8
37 0.83
38 0.85
39 0.84
40 0.79
41 0.76
42 0.71
43 0.62
44 0.6
45 0.54
46 0.51
47 0.48
48 0.51
49 0.46
50 0.46
51 0.45
52 0.39