Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6A6YQD7

Protein Details
Accession A0A6A6YQD7    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
14-38RIGGKGTPRRKVKKVHKSAGTDDKKBasic
NLS Segment(s)
PositionSequence
16-30GGKGTPRRKVKKVHK
Subcellular Location(s) nucl 15, mito_nucl 12.333, cyto_nucl 9.833, mito 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039370  BTF3  
IPR038187  NAC_A/B_dom_sf  
IPR002715  Nas_poly-pep-assoc_cplx_dom  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF01849  NAC  
PROSITE View protein in PROSITE  
PS51151  NAC_AB  
CDD cd22055  NAC_BTF3  
Amino Acid Sequences MDQAKLARMQASVRIGGKGTPRRKVKKVHKSAGTDDKKLQTSLKKLNVQPIQAIEEVNMFKSDGNVIHFSAPKVHASVPANTFAIYGQGEDKELTELVPGILNQLGPDSLASLRKLAESYQSMQKEKGEDGEKGEDEDDDDIPELVEGENFESKGEVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.25
3 0.27
4 0.34
5 0.38
6 0.41
7 0.46
8 0.55
9 0.62
10 0.68
11 0.76
12 0.78
13 0.8
14 0.84
15 0.84
16 0.82
17 0.8
18 0.81
19 0.81
20 0.76
21 0.68
22 0.62
23 0.58
24 0.51
25 0.46
26 0.43
27 0.39
28 0.4
29 0.45
30 0.49
31 0.5
32 0.5
33 0.58
34 0.58
35 0.52
36 0.47
37 0.4
38 0.34
39 0.28
40 0.26
41 0.17
42 0.16
43 0.15
44 0.13
45 0.11
46 0.09
47 0.08
48 0.08
49 0.09
50 0.07
51 0.1
52 0.11
53 0.11
54 0.13
55 0.14
56 0.14
57 0.15
58 0.15
59 0.13
60 0.13
61 0.13
62 0.16
63 0.17
64 0.2
65 0.18
66 0.19
67 0.18
68 0.17
69 0.17
70 0.12
71 0.11
72 0.08
73 0.07
74 0.06
75 0.06
76 0.07
77 0.07
78 0.07
79 0.07
80 0.07
81 0.06
82 0.06
83 0.06
84 0.05
85 0.06
86 0.05
87 0.05
88 0.06
89 0.06
90 0.05
91 0.06
92 0.05
93 0.05
94 0.05
95 0.05
96 0.07
97 0.09
98 0.1
99 0.1
100 0.11
101 0.11
102 0.12
103 0.11
104 0.15
105 0.16
106 0.2
107 0.27
108 0.32
109 0.32
110 0.33
111 0.35
112 0.32
113 0.3
114 0.33
115 0.28
116 0.24
117 0.27
118 0.31
119 0.29
120 0.28
121 0.28
122 0.21
123 0.19
124 0.19
125 0.15
126 0.11
127 0.11
128 0.1
129 0.09
130 0.09
131 0.08
132 0.07
133 0.07
134 0.07
135 0.09
136 0.12
137 0.12
138 0.12