Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6A6YNK2

Protein Details
Accession A0A6A6YNK2    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
15-37VKDPNERRKIQNKLAQRRFRDKVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto_nucl 13.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
PROSITE View protein in PROSITE  
PS00036  BZIP_BASIC  
Amino Acid Sequences SRSSSRSNGDEWSDVKDPNERRKIQNKLAQRRFRDKVREQKEDAEREGENQRRAGSAYASPEPGDLDPGRELSGLPWGGISMRHIVETGKTKEQHSQQSSRENSVYAAASRTGGSSRRLGLRLTDQFARGYPAWRYFPYGHPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.3
3 0.33
4 0.36
5 0.42
6 0.51
7 0.49
8 0.55
9 0.64
10 0.72
11 0.73
12 0.74
13 0.74
14 0.76
15 0.82
16 0.82
17 0.8
18 0.81
19 0.77
20 0.77
21 0.77
22 0.75
23 0.75
24 0.75
25 0.75
26 0.68
27 0.71
28 0.71
29 0.65
30 0.58
31 0.5
32 0.41
33 0.37
34 0.42
35 0.38
36 0.32
37 0.29
38 0.28
39 0.25
40 0.26
41 0.23
42 0.17
43 0.14
44 0.16
45 0.16
46 0.16
47 0.16
48 0.15
49 0.15
50 0.13
51 0.14
52 0.09
53 0.1
54 0.1
55 0.1
56 0.1
57 0.09
58 0.09
59 0.07
60 0.11
61 0.09
62 0.08
63 0.08
64 0.07
65 0.07
66 0.08
67 0.09
68 0.07
69 0.08
70 0.08
71 0.08
72 0.08
73 0.11
74 0.18
75 0.21
76 0.24
77 0.25
78 0.26
79 0.32
80 0.38
81 0.44
82 0.43
83 0.46
84 0.45
85 0.53
86 0.54
87 0.52
88 0.47
89 0.38
90 0.33
91 0.28
92 0.25
93 0.16
94 0.15
95 0.12
96 0.12
97 0.12
98 0.12
99 0.12
100 0.13
101 0.15
102 0.17
103 0.2
104 0.24
105 0.25
106 0.25
107 0.27
108 0.33
109 0.36
110 0.38
111 0.37
112 0.33
113 0.33
114 0.33
115 0.35
116 0.27
117 0.26
118 0.26
119 0.3
120 0.33
121 0.34
122 0.4
123 0.37