Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I7L8G4

Protein Details
Accession I7L8G4    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
50-71ALKKEVTKHKIRPKKKLVVFCNHydrophilic
NLS Segment(s)
PositionSequence
57-65KHKIRPKKK
Subcellular Location(s) cyto 14cyto_nucl 14, nucl 12
Family & Domain DBs
Amino Acid Sequences MDEGNGRTAYVDFSKKVSGFDTDIKILETNTHIFIYVSQCEETIHLYDEALKKEVTKHKIRPKKKLVVFCNMKIHEGFNDIKKVILDILRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.26
4 0.24
5 0.23
6 0.22
7 0.26
8 0.27
9 0.24
10 0.24
11 0.24
12 0.22
13 0.19
14 0.17
15 0.14
16 0.12
17 0.13
18 0.12
19 0.11
20 0.11
21 0.13
22 0.14
23 0.13
24 0.13
25 0.11
26 0.12
27 0.11
28 0.12
29 0.12
30 0.09
31 0.09
32 0.08
33 0.08
34 0.11
35 0.14
36 0.14
37 0.14
38 0.13
39 0.13
40 0.19
41 0.27
42 0.3
43 0.35
44 0.43
45 0.53
46 0.63
47 0.71
48 0.75
49 0.78
50 0.81
51 0.8
52 0.81
53 0.76
54 0.76
55 0.75
56 0.71
57 0.71
58 0.61
59 0.56
60 0.47
61 0.43
62 0.34
63 0.31
64 0.29
65 0.24
66 0.28
67 0.26
68 0.27
69 0.25
70 0.25
71 0.24