Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6A6Y8U1

Protein Details
Accession A0A6A6Y8U1    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
95-114LDANKIRKMHNEDTKKQKKLHydrophilic
NLS Segment(s)
PositionSequence
64-113KAKEKRDTVGLGMKLKSSKNGKAHVPKRPINLDANKIRKMHNEDTKKQKK
Subcellular Location(s) nucl 19, cyto_nucl 13.333, cyto 5.5, cyto_mito 4.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR039146  GPANK1  
Amino Acid Sequences PITNDDLLAHETSMLHIMSRPLQPPPSHIDRTRKGLSYLEAYSYNPDSQTRLGGKGEGILHPIKAKEKRDTVGLGMKLKSSKNGKAHVPKRPINLDANKIRKMHNEDTKKQKKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.09
3 0.09
4 0.11
5 0.15
6 0.18
7 0.19
8 0.21
9 0.26
10 0.26
11 0.28
12 0.33
13 0.37
14 0.39
15 0.43
16 0.49
17 0.49
18 0.56
19 0.57
20 0.51
21 0.45
22 0.41
23 0.38
24 0.33
25 0.29
26 0.24
27 0.21
28 0.19
29 0.2
30 0.2
31 0.18
32 0.14
33 0.13
34 0.13
35 0.13
36 0.16
37 0.15
38 0.15
39 0.15
40 0.14
41 0.14
42 0.15
43 0.15
44 0.11
45 0.12
46 0.11
47 0.11
48 0.12
49 0.13
50 0.16
51 0.2
52 0.24
53 0.27
54 0.31
55 0.32
56 0.33
57 0.34
58 0.31
59 0.32
60 0.31
61 0.29
62 0.26
63 0.26
64 0.26
65 0.25
66 0.29
67 0.28
68 0.33
69 0.35
70 0.4
71 0.47
72 0.55
73 0.62
74 0.64
75 0.67
76 0.65
77 0.66
78 0.66
79 0.62
80 0.6
81 0.59
82 0.58
83 0.6
84 0.61
85 0.6
86 0.57
87 0.56
88 0.55
89 0.57
90 0.58
91 0.59
92 0.62
93 0.65
94 0.75