Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4PEQ2

Protein Details
Accession F4PEQ2   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
37-57KSFLKRQKSVKHKQCDPKKCVHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 18, mito 4, plas 1, pero 1, E.R. 1, golg 1, vacu 1
Family & Domain DBs
Amino Acid Sequences MKFTIFTIAATCIAAVSAASSTPESGVSTNLGKRGLKSFLKRQKSVKHKQCDPKKCVQNYDESYCYSTEAQTDLVPCRAGDQGVCKERAFLACLLGACTCLVATAIISEGLDN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.06
3 0.05
4 0.04
5 0.04
6 0.06
7 0.06
8 0.07
9 0.07
10 0.08
11 0.08
12 0.08
13 0.09
14 0.1
15 0.13
16 0.14
17 0.16
18 0.18
19 0.17
20 0.19
21 0.21
22 0.25
23 0.28
24 0.33
25 0.41
26 0.48
27 0.55
28 0.58
29 0.62
30 0.65
31 0.69
32 0.74
33 0.73
34 0.73
35 0.74
36 0.8
37 0.83
38 0.83
39 0.79
40 0.78
41 0.77
42 0.71
43 0.67
44 0.59
45 0.57
46 0.52
47 0.5
48 0.42
49 0.34
50 0.33
51 0.27
52 0.28
53 0.19
54 0.15
55 0.11
56 0.1
57 0.1
58 0.09
59 0.11
60 0.11
61 0.12
62 0.12
63 0.11
64 0.12
65 0.12
66 0.11
67 0.1
68 0.15
69 0.22
70 0.26
71 0.29
72 0.27
73 0.27
74 0.29
75 0.29
76 0.26
77 0.18
78 0.16
79 0.15
80 0.16
81 0.16
82 0.14
83 0.13
84 0.11
85 0.1
86 0.08
87 0.06
88 0.06
89 0.05
90 0.05
91 0.05
92 0.06
93 0.06