Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6A6Z882

Protein Details
Accession A0A6A6Z882    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MMSTTCRRTYKHPKLPYPKPTPLPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, nucl 9, cyto_nucl 9, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR029526  PGBD  
Pfam View protein in Pfam  
PF13843  DDE_Tnp_1_7  
Amino Acid Sequences MMSTTCRRTYKHPKLPYPKPTPLPAFEPLQINNYDAPGTPNIPPGLDQHDPVALFRLFFTDEMVEKMVRWTNEYAKDHRPSKGSATSIAATRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.89
3 0.9
4 0.87
5 0.85
6 0.79
7 0.76
8 0.7
9 0.63
10 0.57
11 0.5
12 0.44
13 0.37
14 0.36
15 0.29
16 0.28
17 0.25
18 0.21
19 0.18
20 0.16
21 0.14
22 0.11
23 0.12
24 0.1
25 0.11
26 0.11
27 0.13
28 0.13
29 0.12
30 0.13
31 0.12
32 0.17
33 0.16
34 0.16
35 0.14
36 0.15
37 0.15
38 0.14
39 0.16
40 0.1
41 0.1
42 0.09
43 0.1
44 0.09
45 0.09
46 0.11
47 0.09
48 0.09
49 0.1
50 0.12
51 0.11
52 0.1
53 0.13
54 0.15
55 0.14
56 0.16
57 0.18
58 0.23
59 0.32
60 0.36
61 0.39
62 0.43
63 0.51
64 0.52
65 0.53
66 0.5
67 0.44
68 0.47
69 0.49
70 0.43
71 0.38
72 0.39
73 0.37