Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6A6YEH3

Protein Details
Accession A0A6A6YEH3    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
12-38LFSPHKWFVRRQSEKPRRQTEHWENPIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto_nucl 10.5, mito 7, cyto 5
Family & Domain DBs
Amino Acid Sequences MTPNLYLATQTLFSPHKWFVRRQSEKPRRQTEHWENPIAGIYEYIPGRGWYLVATDYPDERLVQPIHVKYSKVLKRYMLQPDYDTRKRHGNIKDAKGKTRNVCFFRLDDGVAWVHCWDDEGHFIPGPYKMWCVDKETNQFRHMLKGDDPFYTSRSNSRADDQIPTSRRSQESRSTQYRGEGSNSRTPNTSQPSTRANSVRGLSAPPTRPGSPRGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.26
3 0.32
4 0.35
5 0.42
6 0.47
7 0.57
8 0.64
9 0.68
10 0.75
11 0.79
12 0.84
13 0.88
14 0.88
15 0.84
16 0.81
17 0.83
18 0.82
19 0.82
20 0.79
21 0.73
22 0.62
23 0.55
24 0.52
25 0.42
26 0.31
27 0.2
28 0.14
29 0.14
30 0.14
31 0.13
32 0.11
33 0.11
34 0.12
35 0.11
36 0.11
37 0.07
38 0.08
39 0.09
40 0.09
41 0.1
42 0.1
43 0.11
44 0.12
45 0.13
46 0.13
47 0.12
48 0.16
49 0.15
50 0.16
51 0.21
52 0.21
53 0.26
54 0.27
55 0.27
56 0.24
57 0.34
58 0.36
59 0.34
60 0.36
61 0.33
62 0.35
63 0.42
64 0.49
65 0.41
66 0.38
67 0.37
68 0.41
69 0.47
70 0.48
71 0.43
72 0.36
73 0.41
74 0.42
75 0.47
76 0.45
77 0.46
78 0.5
79 0.56
80 0.63
81 0.57
82 0.62
83 0.59
84 0.59
85 0.54
86 0.53
87 0.52
88 0.46
89 0.47
90 0.42
91 0.38
92 0.36
93 0.32
94 0.24
95 0.17
96 0.15
97 0.12
98 0.11
99 0.1
100 0.07
101 0.06
102 0.05
103 0.06
104 0.05
105 0.05
106 0.08
107 0.09
108 0.1
109 0.1
110 0.11
111 0.11
112 0.11
113 0.12
114 0.1
115 0.1
116 0.1
117 0.13
118 0.14
119 0.21
120 0.24
121 0.29
122 0.38
123 0.44
124 0.46
125 0.45
126 0.47
127 0.4
128 0.43
129 0.38
130 0.31
131 0.27
132 0.29
133 0.3
134 0.27
135 0.28
136 0.23
137 0.24
138 0.24
139 0.22
140 0.2
141 0.21
142 0.24
143 0.24
144 0.26
145 0.29
146 0.28
147 0.31
148 0.31
149 0.36
150 0.36
151 0.37
152 0.36
153 0.37
154 0.39
155 0.38
156 0.4
157 0.42
158 0.48
159 0.55
160 0.58
161 0.57
162 0.55
163 0.55
164 0.53
165 0.46
166 0.42
167 0.39
168 0.38
169 0.43
170 0.44
171 0.4
172 0.39
173 0.39
174 0.42
175 0.44
176 0.44
177 0.38
178 0.41
179 0.46
180 0.48
181 0.53
182 0.48
183 0.43
184 0.43
185 0.41
186 0.39
187 0.34
188 0.33
189 0.31
190 0.35
191 0.36
192 0.36
193 0.4
194 0.39
195 0.41