Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6A6Y3S3

Protein Details
Accession A0A6A6Y3S3    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
9-35STSLARIRDNQRRSRVRRKEYLHKLETHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 11, cyto_nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
Amino Acid Sequences MSDAPALKSTSLARIRDNQRRSRVRRKEYLHKLETKLRAYKQTGVEAAAGGHGLLSDAASVWRGTRALSISLFPTRC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.47
3 0.55
4 0.61
5 0.61
6 0.65
7 0.73
8 0.79
9 0.8
10 0.82
11 0.81
12 0.82
13 0.81
14 0.82
15 0.82
16 0.83
17 0.78
18 0.73
19 0.69
20 0.67
21 0.65
22 0.58
23 0.53
24 0.45
25 0.45
26 0.41
27 0.43
28 0.39
29 0.36
30 0.32
31 0.27
32 0.26
33 0.2
34 0.17
35 0.11
36 0.09
37 0.05
38 0.04
39 0.03
40 0.03
41 0.03
42 0.03
43 0.03
44 0.03
45 0.03
46 0.05
47 0.05
48 0.05
49 0.07
50 0.08
51 0.08
52 0.11
53 0.13
54 0.15
55 0.16
56 0.18
57 0.2