Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6A6Y3Q5

Protein Details
Accession A0A6A6Y3Q5    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
127-152WDEFYRVRDGRRKKKTTKMRWFGIEPHydrophilic
NLS Segment(s)
PositionSequence
136-142GRRKKKT
Subcellular Location(s) nucl 14.5, mito 9, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MPFTKQKKTENVSKTIRFAEAPCQLGVPERAVVKQTPGSKTRAADEEEGSSYSPNRSTSLTYPTGRSLFPYPTIPSQISTSPSTVVTLPASRLYSTGASWNPKPAITAFHEPSLAPAATLPDSRNPWDEFYRVRDGRRKKKTTKMRWFGIEP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.58
3 0.53
4 0.45
5 0.4
6 0.39
7 0.36
8 0.34
9 0.3
10 0.27
11 0.25
12 0.27
13 0.27
14 0.2
15 0.17
16 0.15
17 0.16
18 0.18
19 0.18
20 0.19
21 0.22
22 0.26
23 0.28
24 0.3
25 0.33
26 0.35
27 0.35
28 0.35
29 0.34
30 0.31
31 0.29
32 0.27
33 0.26
34 0.23
35 0.23
36 0.19
37 0.16
38 0.14
39 0.12
40 0.13
41 0.11
42 0.11
43 0.12
44 0.15
45 0.16
46 0.22
47 0.26
48 0.25
49 0.25
50 0.27
51 0.27
52 0.24
53 0.24
54 0.2
55 0.17
56 0.17
57 0.18
58 0.17
59 0.17
60 0.2
61 0.18
62 0.17
63 0.17
64 0.16
65 0.17
66 0.17
67 0.16
68 0.14
69 0.14
70 0.14
71 0.12
72 0.12
73 0.1
74 0.09
75 0.09
76 0.11
77 0.11
78 0.11
79 0.11
80 0.11
81 0.11
82 0.11
83 0.14
84 0.15
85 0.18
86 0.19
87 0.23
88 0.22
89 0.21
90 0.22
91 0.18
92 0.2
93 0.22
94 0.29
95 0.26
96 0.27
97 0.27
98 0.26
99 0.27
100 0.26
101 0.2
102 0.13
103 0.11
104 0.12
105 0.13
106 0.15
107 0.15
108 0.17
109 0.2
110 0.22
111 0.26
112 0.26
113 0.29
114 0.31
115 0.32
116 0.3
117 0.34
118 0.41
119 0.4
120 0.45
121 0.5
122 0.57
123 0.65
124 0.72
125 0.76
126 0.75
127 0.83
128 0.88
129 0.9
130 0.91
131 0.89
132 0.87