Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4P2A7

Protein Details
Accession F4P2A7   
Localization Confidence Low
Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
7-33DVPMSTKSKTKSQKSKPGNKRNSESDSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, cyto_nucl 10.5, cyto 8.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016197  Chromo-like_dom_sf  
IPR008251  Chromo_shadow_dom  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF01393  Chromo_shadow  
Amino Acid Sequences MVSVYPDVPMSTKSKTKSQKSKPGNKRNSESDSFTKQDTVDTDEQDDLSKVYHLIDSLSRAVLDKASWENDVVNIETMEASATGEDDLAVYINWKNGKKTVVSSKVANTKCPQKIIKFYENHIKFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.46
3 0.56
4 0.64
5 0.7
6 0.76
7 0.81
8 0.89
9 0.9
10 0.92
11 0.92
12 0.89
13 0.85
14 0.82
15 0.79
16 0.72
17 0.67
18 0.62
19 0.57
20 0.51
21 0.45
22 0.38
23 0.31
24 0.28
25 0.23
26 0.24
27 0.2
28 0.2
29 0.21
30 0.19
31 0.19
32 0.18
33 0.17
34 0.1
35 0.08
36 0.08
37 0.06
38 0.06
39 0.06
40 0.06
41 0.06
42 0.07
43 0.09
44 0.09
45 0.09
46 0.08
47 0.08
48 0.08
49 0.08
50 0.07
51 0.07
52 0.07
53 0.09
54 0.09
55 0.09
56 0.09
57 0.09
58 0.11
59 0.09
60 0.08
61 0.07
62 0.07
63 0.06
64 0.06
65 0.05
66 0.04
67 0.04
68 0.03
69 0.04
70 0.03
71 0.03
72 0.03
73 0.03
74 0.03
75 0.04
76 0.04
77 0.05
78 0.05
79 0.09
80 0.14
81 0.15
82 0.17
83 0.2
84 0.23
85 0.24
86 0.3
87 0.37
88 0.4
89 0.42
90 0.43
91 0.47
92 0.54
93 0.53
94 0.51
95 0.47
96 0.49
97 0.5
98 0.54
99 0.54
100 0.52
101 0.6
102 0.64
103 0.67
104 0.61
105 0.62
106 0.66