Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F4P0B9

Protein Details
Accession F4P0B9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
38-61AEGKKKKVTGRAKKRLQYNRRFVNHydrophilic
NLS Segment(s)
PositionSequence
24-53RAGKVKGQTPKVEKAEGKKKKVTGRAKKRL
Subcellular Location(s) mito 11, cyto 9, mito_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MTDEISLDFKWCYQQGKVHGSLARAGKVKGQTPKVEKAEGKKKKVTGRAKKRLQYNRRFVNAVASFGKRKMNPSPNQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.33
3 0.39
4 0.41
5 0.41
6 0.4
7 0.38
8 0.4
9 0.36
10 0.32
11 0.27
12 0.25
13 0.25
14 0.26
15 0.3
16 0.31
17 0.33
18 0.36
19 0.39
20 0.46
21 0.45
22 0.46
23 0.43
24 0.44
25 0.5
26 0.52
27 0.52
28 0.49
29 0.52
30 0.54
31 0.62
32 0.65
33 0.65
34 0.69
35 0.74
36 0.79
37 0.79
38 0.83
39 0.84
40 0.83
41 0.83
42 0.81
43 0.8
44 0.76
45 0.72
46 0.62
47 0.61
48 0.52
49 0.46
50 0.4
51 0.34
52 0.32
53 0.33
54 0.4
55 0.31
56 0.35
57 0.41
58 0.47