Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6A6Y9Y3

Protein Details
Accession A0A6A6Y9Y3    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
5-32CDPCEKRAITFSRRRRRSRTREASGPHLHydrophilic
NLS Segment(s)
PositionSequence
17-28RRRRRSRTREAS
Subcellular Location(s) nucl 19.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
Amino Acid Sequences MARICDPCEKRAITFSRRRRRSRTREASGPHLPPPRPAAVSKCSSMPYLKPQITKGEGDGVHVHRRAPPAEVSAWYLQTALSSPTDPPTMSPRTPHLGHPAISTPPHPGENSYPMLRIA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.62
3 0.66
4 0.74
5 0.81
6 0.82
7 0.86
8 0.87
9 0.88
10 0.88
11 0.85
12 0.84
13 0.8
14 0.78
15 0.74
16 0.67
17 0.62
18 0.58
19 0.5
20 0.44
21 0.44
22 0.39
23 0.34
24 0.33
25 0.31
26 0.3
27 0.32
28 0.3
29 0.28
30 0.26
31 0.25
32 0.25
33 0.22
34 0.24
35 0.29
36 0.3
37 0.3
38 0.31
39 0.34
40 0.35
41 0.33
42 0.26
43 0.24
44 0.21
45 0.21
46 0.22
47 0.2
48 0.22
49 0.22
50 0.21
51 0.19
52 0.21
53 0.2
54 0.18
55 0.17
56 0.16
57 0.16
58 0.17
59 0.18
60 0.17
61 0.17
62 0.15
63 0.14
64 0.11
65 0.1
66 0.1
67 0.08
68 0.08
69 0.08
70 0.08
71 0.11
72 0.12
73 0.12
74 0.13
75 0.18
76 0.22
77 0.23
78 0.25
79 0.27
80 0.32
81 0.34
82 0.35
83 0.38
84 0.36
85 0.36
86 0.36
87 0.35
88 0.32
89 0.32
90 0.29
91 0.26
92 0.25
93 0.27
94 0.25
95 0.26
96 0.28
97 0.32
98 0.37
99 0.33