Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6A6YBY4

Protein Details
Accession A0A6A6YBY4    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
16-47SALHRLLHRSPSKRKPKTKRDEKRQKQEDALABasic
NLS Segment(s)
PositionSequence
23-40HRSPSKRKPKTKRDEKRQ
Subcellular Location(s) nucl 11.5, mito 11, cyto_nucl 8.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MSSPTPTPDPPTSPPSALHRLLHRSPSKRKPKTKRDEKRQKQEDALAPSVANEVEVAERAGTAKPAPTHQTGHMRGGAGSPAPGDGGAMERRERGFDPLPGLLKMREEWVRGFAEEVGREGEGEEGMDILEKEDGNEKDEEGMNLAKKENAEEEKGGEGPRFVPGSPIGRVGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.43
3 0.46
4 0.44
5 0.43
6 0.43
7 0.47
8 0.49
9 0.55
10 0.56
11 0.57
12 0.64
13 0.7
14 0.75
15 0.78
16 0.85
17 0.86
18 0.89
19 0.92
20 0.93
21 0.94
22 0.94
23 0.95
24 0.96
25 0.96
26 0.93
27 0.87
28 0.81
29 0.77
30 0.72
31 0.67
32 0.59
33 0.48
34 0.39
35 0.33
36 0.29
37 0.21
38 0.14
39 0.07
40 0.06
41 0.05
42 0.06
43 0.06
44 0.05
45 0.05
46 0.06
47 0.06
48 0.06
49 0.06
50 0.09
51 0.09
52 0.12
53 0.16
54 0.17
55 0.2
56 0.23
57 0.32
58 0.31
59 0.33
60 0.32
61 0.28
62 0.26
63 0.24
64 0.2
65 0.11
66 0.09
67 0.07
68 0.05
69 0.05
70 0.04
71 0.04
72 0.03
73 0.05
74 0.06
75 0.07
76 0.08
77 0.09
78 0.09
79 0.11
80 0.12
81 0.15
82 0.16
83 0.16
84 0.18
85 0.19
86 0.2
87 0.19
88 0.2
89 0.15
90 0.14
91 0.13
92 0.14
93 0.14
94 0.15
95 0.15
96 0.17
97 0.18
98 0.17
99 0.17
100 0.15
101 0.15
102 0.14
103 0.14
104 0.12
105 0.1
106 0.1
107 0.1
108 0.09
109 0.06
110 0.06
111 0.05
112 0.04
113 0.04
114 0.04
115 0.04
116 0.04
117 0.06
118 0.05
119 0.06
120 0.13
121 0.14
122 0.16
123 0.16
124 0.16
125 0.18
126 0.19
127 0.19
128 0.14
129 0.17
130 0.17
131 0.18
132 0.19
133 0.17
134 0.17
135 0.19
136 0.23
137 0.23
138 0.25
139 0.25
140 0.26
141 0.27
142 0.28
143 0.27
144 0.21
145 0.18
146 0.15
147 0.19
148 0.18
149 0.16
150 0.17
151 0.2
152 0.24
153 0.25