Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A6A6XYD1

Protein Details
Accession A0A6A6XYD1    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MPISKKDRRTREHKKGDAAGBasic
NLS Segment(s)
PositionSequence
5-17KKDRRTREHKKGD
Subcellular Location(s) cyto 9.5, cyto_nucl 9.5, nucl 8.5, mito 8
Family & Domain DBs
Amino Acid Sequences MPISKKDRRTREHKKGDAAGTRAAVRPNGTPVKAPKPTSICQNCRKEIVSTMRVQLEDHASTHSGEWTKEKCWPNDFPAEGAAGAATT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.8
3 0.79
4 0.74
5 0.66
6 0.57
7 0.48
8 0.43
9 0.37
10 0.31
11 0.25
12 0.2
13 0.18
14 0.22
15 0.24
16 0.23
17 0.25
18 0.28
19 0.35
20 0.39
21 0.4
22 0.38
23 0.4
24 0.41
25 0.47
26 0.51
27 0.5
28 0.54
29 0.58
30 0.54
31 0.51
32 0.51
33 0.42
34 0.39
35 0.39
36 0.34
37 0.29
38 0.3
39 0.29
40 0.28
41 0.27
42 0.23
43 0.2
44 0.17
45 0.15
46 0.14
47 0.14
48 0.14
49 0.14
50 0.16
51 0.13
52 0.13
53 0.18
54 0.19
55 0.2
56 0.28
57 0.34
58 0.35
59 0.4
60 0.44
61 0.44
62 0.5
63 0.5
64 0.43
65 0.38
66 0.34
67 0.29
68 0.24