Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6A6YWE9

Protein Details
Accession A0A6A6YWE9    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
44-71SVRDRRPPAVRVQSRRRRRRAASGPGVVHydrophilic
NLS Segment(s)
PositionSequence
48-64RRPPAVRVQSRRRRRRA
Subcellular Location(s) extr 15, cyto 4, nucl 3, mito 3, mito_nucl 3
Family & Domain DBs
Amino Acid Sequences MGTVGDFLVLPSAVLGLWPLGPHANAAASSPTRPHSGLELGTQSVRDRRPPAVRVQSRRRRRRAASGPGVVSAVDVLATACSLVSTVEVDRGPKTVEIAEISVNLTQLACRPPPWAPTPRWNRAGAVDGGFSAAYLPGNFAGASRARHGSLPSLPQRWGRPQDRGPLWDMAEGQASAVSSGLCSLHHAELLQQGRSSHSHLRNDSNLDDLSLAATLPRLTLVGVSVSERKQTRNLRGPLAPNEGRNTVPESQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.05
5 0.06
6 0.07
7 0.08
8 0.08
9 0.09
10 0.09
11 0.1
12 0.09
13 0.11
14 0.14
15 0.14
16 0.16
17 0.18
18 0.19
19 0.21
20 0.22
21 0.22
22 0.21
23 0.23
24 0.23
25 0.24
26 0.24
27 0.22
28 0.22
29 0.22
30 0.2
31 0.23
32 0.24
33 0.26
34 0.27
35 0.33
36 0.4
37 0.43
38 0.5
39 0.55
40 0.62
41 0.66
42 0.74
43 0.77
44 0.8
45 0.88
46 0.87
47 0.86
48 0.83
49 0.84
50 0.83
51 0.83
52 0.81
53 0.77
54 0.69
55 0.59
56 0.54
57 0.42
58 0.32
59 0.21
60 0.12
61 0.05
62 0.04
63 0.03
64 0.03
65 0.03
66 0.03
67 0.03
68 0.03
69 0.03
70 0.03
71 0.03
72 0.04
73 0.05
74 0.07
75 0.08
76 0.09
77 0.1
78 0.11
79 0.11
80 0.1
81 0.11
82 0.09
83 0.1
84 0.09
85 0.1
86 0.09
87 0.09
88 0.09
89 0.09
90 0.08
91 0.07
92 0.06
93 0.05
94 0.07
95 0.09
96 0.09
97 0.09
98 0.11
99 0.13
100 0.16
101 0.21
102 0.25
103 0.26
104 0.35
105 0.43
106 0.47
107 0.5
108 0.47
109 0.43
110 0.39
111 0.38
112 0.3
113 0.22
114 0.16
115 0.12
116 0.11
117 0.1
118 0.08
119 0.05
120 0.04
121 0.04
122 0.03
123 0.04
124 0.03
125 0.04
126 0.04
127 0.04
128 0.06
129 0.08
130 0.09
131 0.11
132 0.12
133 0.13
134 0.14
135 0.14
136 0.16
137 0.16
138 0.22
139 0.25
140 0.26
141 0.27
142 0.3
143 0.33
144 0.37
145 0.43
146 0.4
147 0.43
148 0.45
149 0.53
150 0.52
151 0.51
152 0.46
153 0.4
154 0.37
155 0.31
156 0.28
157 0.19
158 0.17
159 0.15
160 0.11
161 0.09
162 0.08
163 0.06
164 0.06
165 0.05
166 0.04
167 0.04
168 0.05
169 0.04
170 0.06
171 0.09
172 0.09
173 0.1
174 0.1
175 0.11
176 0.17
177 0.2
178 0.19
179 0.18
180 0.18
181 0.2
182 0.22
183 0.25
184 0.28
185 0.32
186 0.39
187 0.41
188 0.47
189 0.48
190 0.51
191 0.47
192 0.41
193 0.34
194 0.27
195 0.24
196 0.18
197 0.14
198 0.1
199 0.09
200 0.05
201 0.06
202 0.05
203 0.05
204 0.06
205 0.05
206 0.05
207 0.06
208 0.07
209 0.07
210 0.08
211 0.11
212 0.15
213 0.16
214 0.23
215 0.24
216 0.26
217 0.34
218 0.42
219 0.5
220 0.56
221 0.6
222 0.6
223 0.65
224 0.68
225 0.66
226 0.66
227 0.6
228 0.53
229 0.53
230 0.49
231 0.43
232 0.39