Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6A6YAJ8

Protein Details
Accession A0A6A6YAJ8    Localization Confidence Low Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
6-26TWHPSLSRSERQTNRKQRGFTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 7, cyto 7, cyto_nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR002891  APS_kinase  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0004020  F:adenylylsulfate kinase activity  
GO:0005524  F:ATP binding  
GO:0070814  P:hydrogen sulfide biosynthetic process  
GO:0016310  P:phosphorylation  
GO:0000103  P:sulfate assimilation  
Pfam View protein in Pfam  
PF01583  APS_kinase  
CDD cd02027  APSK  
Amino Acid Sequences MATNITWHPSLSRSERQTNRKQRGFTLWFTGLSASGKSTIATALEQHLLHLGLAAYRLDGDNVRFGLNKDLGFSEADRNENIRRIGEVAKLFADSATIAITSFISPYRKDRQVARDLHAAKNAANPEDEPLPFIEVFVDIPLEVAEQRDPKGLYKKAREGKIPEFTGISAPYEAPESPEIHIRSDLKSVEESVVAIVDYLNSKGLLKLNSSDGRGLEY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.58
3 0.66
4 0.75
5 0.79
6 0.83
7 0.8
8 0.77
9 0.72
10 0.73
11 0.69
12 0.62
13 0.59
14 0.5
15 0.44
16 0.41
17 0.36
18 0.27
19 0.23
20 0.19
21 0.12
22 0.12
23 0.11
24 0.11
25 0.11
26 0.1
27 0.1
28 0.1
29 0.1
30 0.11
31 0.14
32 0.13
33 0.13
34 0.14
35 0.13
36 0.12
37 0.12
38 0.09
39 0.06
40 0.07
41 0.07
42 0.06
43 0.06
44 0.06
45 0.06
46 0.08
47 0.08
48 0.1
49 0.11
50 0.12
51 0.12
52 0.13
53 0.18
54 0.19
55 0.18
56 0.16
57 0.16
58 0.16
59 0.16
60 0.16
61 0.17
62 0.16
63 0.17
64 0.16
65 0.18
66 0.19
67 0.22
68 0.22
69 0.17
70 0.16
71 0.17
72 0.18
73 0.2
74 0.18
75 0.16
76 0.15
77 0.15
78 0.14
79 0.11
80 0.1
81 0.06
82 0.05
83 0.04
84 0.04
85 0.04
86 0.04
87 0.04
88 0.04
89 0.05
90 0.06
91 0.08
92 0.08
93 0.13
94 0.2
95 0.23
96 0.25
97 0.3
98 0.35
99 0.42
100 0.45
101 0.43
102 0.45
103 0.44
104 0.43
105 0.4
106 0.34
107 0.26
108 0.26
109 0.24
110 0.17
111 0.14
112 0.13
113 0.13
114 0.14
115 0.14
116 0.11
117 0.1
118 0.12
119 0.11
120 0.11
121 0.09
122 0.07
123 0.07
124 0.06
125 0.06
126 0.04
127 0.04
128 0.04
129 0.04
130 0.04
131 0.05
132 0.07
133 0.08
134 0.09
135 0.13
136 0.13
137 0.17
138 0.25
139 0.31
140 0.37
141 0.42
142 0.51
143 0.56
144 0.59
145 0.61
146 0.6
147 0.61
148 0.62
149 0.56
150 0.48
151 0.41
152 0.37
153 0.33
154 0.27
155 0.21
156 0.13
157 0.12
158 0.11
159 0.12
160 0.12
161 0.12
162 0.14
163 0.14
164 0.14
165 0.21
166 0.22
167 0.22
168 0.26
169 0.25
170 0.25
171 0.28
172 0.28
173 0.23
174 0.24
175 0.23
176 0.2
177 0.19
178 0.17
179 0.12
180 0.12
181 0.09
182 0.08
183 0.06
184 0.06
185 0.07
186 0.08
187 0.08
188 0.08
189 0.09
190 0.12
191 0.16
192 0.17
193 0.19
194 0.21
195 0.28
196 0.32
197 0.33
198 0.34