Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A6A6Z6V8

Protein Details
Accession A0A6A6Z6V8    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MAPSATGGKKQKKKWSKGKVKDKANHAVVHydrophilic
NLS Segment(s)
PositionSequence
8-23GKKQKKKWSKGKVKDK
Subcellular Location(s) nucl 14.5, cyto_nucl 10, mito 7, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPSATGGKKQKKKWSKGKVKDKANHAVVLDKSISDKLQKDVQSYRLITVATLVDRLKINGSLARRALVDLEEKGLIKKVVGHSKLSIYSEEPLEMPVGRETSIIC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.87
3 0.88
4 0.9
5 0.93
6 0.92
7 0.92
8 0.88
9 0.85
10 0.83
11 0.75
12 0.67
13 0.56
14 0.52
15 0.41
16 0.37
17 0.29
18 0.2
19 0.18
20 0.16
21 0.16
22 0.14
23 0.16
24 0.16
25 0.22
26 0.23
27 0.25
28 0.27
29 0.3
30 0.32
31 0.31
32 0.29
33 0.24
34 0.22
35 0.18
36 0.17
37 0.13
38 0.08
39 0.09
40 0.08
41 0.09
42 0.09
43 0.09
44 0.09
45 0.09
46 0.09
47 0.11
48 0.12
49 0.15
50 0.15
51 0.15
52 0.15
53 0.15
54 0.14
55 0.13
56 0.13
57 0.1
58 0.11
59 0.11
60 0.11
61 0.12
62 0.13
63 0.12
64 0.1
65 0.14
66 0.19
67 0.27
68 0.29
69 0.31
70 0.31
71 0.35
72 0.38
73 0.35
74 0.3
75 0.23
76 0.23
77 0.21
78 0.2
79 0.17
80 0.15
81 0.15
82 0.14
83 0.13
84 0.14
85 0.14
86 0.13