Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6A6XYV2

Protein Details
Accession A0A6A6XYV2    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
16-35CEHSSKRDSRHPPRDNNDICHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 11.5, mito 6, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017449  Pro-tRNA_synth_II  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005524  F:ATP binding  
GO:0004827  F:proline-tRNA ligase activity  
GO:0006433  P:prolyl-tRNA aminoacylation  
Amino Acid Sequences MHRDRICPPTSLRCLCEHSSKRDSRHPPRDNNDICPSSSAAPFAPDATATETIKISVLDTHCNGDKCEVEVNNISARKEAGDNTVMDWNSSAMGAKSSCIPSSSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.5
3 0.55
4 0.51
5 0.5
6 0.56
7 0.59
8 0.6
9 0.64
10 0.7
11 0.71
12 0.76
13 0.77
14 0.77
15 0.77
16 0.82
17 0.75
18 0.71
19 0.68
20 0.58
21 0.5
22 0.42
23 0.37
24 0.29
25 0.26
26 0.2
27 0.12
28 0.12
29 0.12
30 0.1
31 0.09
32 0.07
33 0.08
34 0.1
35 0.12
36 0.11
37 0.11
38 0.11
39 0.11
40 0.11
41 0.1
42 0.07
43 0.08
44 0.09
45 0.11
46 0.11
47 0.13
48 0.16
49 0.16
50 0.17
51 0.16
52 0.15
53 0.14
54 0.18
55 0.16
56 0.17
57 0.18
58 0.19
59 0.23
60 0.24
61 0.22
62 0.19
63 0.19
64 0.17
65 0.17
66 0.16
67 0.15
68 0.16
69 0.16
70 0.17
71 0.22
72 0.21
73 0.2
74 0.19
75 0.15
76 0.13
77 0.13
78 0.11
79 0.07
80 0.09
81 0.09
82 0.1
83 0.14
84 0.17
85 0.17