Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6A6Z9C5

Protein Details
Accession A0A6A6Z9C5    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
22-41QDDFRRWWQRQQEQIRRLVQHydrophilic
210-238ISQEDFRRLWQQRRQQRQQPASQRQRVVSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MPLEEEEFQRRRRQIGLREMSQDDFRRWWQRQQEQIRRLVQQRQQTISQLQQADNTVVHAGRELQMQQQEQPWQQVSWWQRQRHPVPQHQPMPQLQPVPQHQPIPQRQAIPQRQPANVRAVWIEELSRGQQEQLGCLLQLVSTAPIEEEEFQRRWRQIGFRDMSQEEFRRWWRERQQRGQTIRMAQLIQALPLEEEEFHRRRRQVPFQEISQEDFRRLWQQRRQQRQQPASQRQRVVSAVSTPTQTSPRNEEEVYT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.61
3 0.66
4 0.62
5 0.65
6 0.64
7 0.59
8 0.57
9 0.51
10 0.43
11 0.38
12 0.4
13 0.44
14 0.45
15 0.51
16 0.54
17 0.6
18 0.67
19 0.75
20 0.78
21 0.76
22 0.81
23 0.77
24 0.73
25 0.7
26 0.69
27 0.63
28 0.61
29 0.61
30 0.57
31 0.55
32 0.52
33 0.51
34 0.46
35 0.46
36 0.4
37 0.34
38 0.32
39 0.3
40 0.28
41 0.23
42 0.2
43 0.15
44 0.12
45 0.12
46 0.1
47 0.1
48 0.09
49 0.12
50 0.11
51 0.14
52 0.18
53 0.19
54 0.21
55 0.23
56 0.27
57 0.26
58 0.29
59 0.27
60 0.23
61 0.22
62 0.27
63 0.28
64 0.33
65 0.4
66 0.4
67 0.44
68 0.53
69 0.59
70 0.62
71 0.66
72 0.65
73 0.66
74 0.7
75 0.72
76 0.66
77 0.64
78 0.57
79 0.54
80 0.47
81 0.41
82 0.33
83 0.33
84 0.33
85 0.35
86 0.35
87 0.32
88 0.32
89 0.39
90 0.42
91 0.43
92 0.43
93 0.38
94 0.39
95 0.47
96 0.51
97 0.49
98 0.51
99 0.49
100 0.49
101 0.5
102 0.48
103 0.43
104 0.37
105 0.31
106 0.24
107 0.2
108 0.18
109 0.15
110 0.13
111 0.08
112 0.08
113 0.08
114 0.08
115 0.07
116 0.06
117 0.08
118 0.08
119 0.08
120 0.09
121 0.08
122 0.07
123 0.07
124 0.07
125 0.05
126 0.05
127 0.05
128 0.04
129 0.04
130 0.04
131 0.04
132 0.04
133 0.05
134 0.06
135 0.08
136 0.12
137 0.13
138 0.15
139 0.19
140 0.2
141 0.2
142 0.23
143 0.26
144 0.27
145 0.35
146 0.37
147 0.34
148 0.39
149 0.38
150 0.38
151 0.37
152 0.33
153 0.25
154 0.26
155 0.28
156 0.31
157 0.33
158 0.39
159 0.45
160 0.54
161 0.62
162 0.69
163 0.75
164 0.77
165 0.8
166 0.76
167 0.71
168 0.64
169 0.58
170 0.49
171 0.39
172 0.3
173 0.3
174 0.25
175 0.21
176 0.17
177 0.14
178 0.11
179 0.11
180 0.12
181 0.07
182 0.1
183 0.17
184 0.2
185 0.24
186 0.3
187 0.33
188 0.39
189 0.48
190 0.55
191 0.58
192 0.65
193 0.65
194 0.63
195 0.68
196 0.62
197 0.58
198 0.54
199 0.45
200 0.38
201 0.34
202 0.32
203 0.34
204 0.39
205 0.44
206 0.46
207 0.55
208 0.63
209 0.74
210 0.82
211 0.81
212 0.86
213 0.86
214 0.87
215 0.87
216 0.88
217 0.88
218 0.86
219 0.82
220 0.73
221 0.68
222 0.6
223 0.52
224 0.43
225 0.38
226 0.33
227 0.3
228 0.3
229 0.27
230 0.28
231 0.31
232 0.32
233 0.32
234 0.35
235 0.39
236 0.42