Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6A6YW31

Protein Details
Accession A0A6A6YW31    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
51-77FTRSSSREKNCNNKRRKRISEILNTVIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 15
Family & Domain DBs
Amino Acid Sequences MPDQFDTPGSGQLHNSNIPQGARGVGHQGGYNTQDDIFEDDDGDGVPQVLFTRSSSREKNCNNKRRKRISEILNTVIKNAYPDT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.25
3 0.21
4 0.22
5 0.2
6 0.19
7 0.17
8 0.15
9 0.13
10 0.13
11 0.14
12 0.13
13 0.13
14 0.13
15 0.13
16 0.13
17 0.15
18 0.15
19 0.11
20 0.1
21 0.1
22 0.09
23 0.11
24 0.1
25 0.08
26 0.08
27 0.07
28 0.07
29 0.07
30 0.07
31 0.04
32 0.03
33 0.03
34 0.03
35 0.04
36 0.04
37 0.05
38 0.06
39 0.11
40 0.15
41 0.21
42 0.26
43 0.3
44 0.39
45 0.46
46 0.56
47 0.62
48 0.69
49 0.74
50 0.79
51 0.86
52 0.88
53 0.88
54 0.86
55 0.85
56 0.85
57 0.85
58 0.81
59 0.77
60 0.72
61 0.64
62 0.56
63 0.48
64 0.38