Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6A6Y7P7

Protein Details
Accession A0A6A6Y7P7    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
34-65NPKGRPVKQCEHCRGARKSKSHHAKCDCGDKKBasic
NLS Segment(s)
Subcellular Location(s) cyto 13, cyto_nucl 12.833, nucl 11.5, cyto_mito 7.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR001083  Cu_fist_DNA-bd_dom  
IPR036395  Cu_fist_DNA-bd_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0005507  F:copper ion binding  
GO:0003677  F:DNA binding  
GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF00649  Copper-fist  
PROSITE View protein in PROSITE  
PS50073  COPPER_FIST_2  
Amino Acid Sequences MPTFEGEKWACASCIKGHRVSGCTHTDRELHHINPKGRPVKQCEHCRGARKSKSHHAKCDCGDKKDKDKAKDKGDLKGELLAGVSVEGISNLSAVGGHNCGCHSGATCTCGLVKKESLDLKLDTGALKLAQHPPKPKPRLTATQSESTLTVFANGHHKPCHRLNNAAHVSGAPYKIPRPHTLHDPLGHYSHDNIKRIYEQPNNPAQRSLDTLSLSNSNFYSVFSSPAQRSVDSLPLASSDGMFNGTYAPFDPQKPMFAKHPENGLPHDGSSPDSQLSDTIPSQTQWAWTPTTASRNGTFGLDSLSTSPSQEYLPALENDWAIPSAGINPSWSAKDLPLVPNRSANAFPISQSGESNKQSVPNLTPSSSGAQSEIGEPNMFENVEYTAPQSVMGESLPWDESAQFRDAPSYRMRAATGGSEFRQAPTSAPGNDARRSLDLDFTKRFNESLLEQGVNSNFMPFQSPNIEASKGMSGAPTYAPTSVPVDGNSLYSTDEYAPRSIMIPNNIEDIPTSNPWLGFDDVTNFGLTSFDPPLDLSVDVSNYPAGGPWI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.37
3 0.39
4 0.42
5 0.47
6 0.49
7 0.49
8 0.48
9 0.47
10 0.46
11 0.44
12 0.43
13 0.41
14 0.41
15 0.44
16 0.44
17 0.4
18 0.43
19 0.49
20 0.51
21 0.54
22 0.61
23 0.62
24 0.62
25 0.66
26 0.67
27 0.69
28 0.74
29 0.78
30 0.77
31 0.77
32 0.78
33 0.79
34 0.8
35 0.81
36 0.8
37 0.78
38 0.77
39 0.79
40 0.84
41 0.83
42 0.84
43 0.81
44 0.81
45 0.77
46 0.8
47 0.76
48 0.72
49 0.73
50 0.7
51 0.72
52 0.74
53 0.77
54 0.75
55 0.78
56 0.79
57 0.78
58 0.8
59 0.73
60 0.71
61 0.69
62 0.63
63 0.55
64 0.5
65 0.41
66 0.32
67 0.29
68 0.2
69 0.14
70 0.11
71 0.09
72 0.05
73 0.04
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.04
81 0.05
82 0.06
83 0.08
84 0.08
85 0.09
86 0.09
87 0.11
88 0.11
89 0.11
90 0.12
91 0.15
92 0.16
93 0.18
94 0.18
95 0.17
96 0.19
97 0.22
98 0.22
99 0.22
100 0.23
101 0.22
102 0.28
103 0.31
104 0.31
105 0.3
106 0.3
107 0.27
108 0.25
109 0.25
110 0.19
111 0.15
112 0.14
113 0.11
114 0.11
115 0.13
116 0.21
117 0.27
118 0.32
119 0.39
120 0.47
121 0.57
122 0.63
123 0.63
124 0.62
125 0.63
126 0.67
127 0.66
128 0.67
129 0.61
130 0.61
131 0.58
132 0.51
133 0.44
134 0.34
135 0.3
136 0.19
137 0.17
138 0.1
139 0.11
140 0.17
141 0.18
142 0.21
143 0.24
144 0.26
145 0.3
146 0.38
147 0.46
148 0.42
149 0.49
150 0.49
151 0.55
152 0.57
153 0.51
154 0.44
155 0.33
156 0.32
157 0.27
158 0.25
159 0.15
160 0.13
161 0.16
162 0.21
163 0.25
164 0.3
165 0.33
166 0.36
167 0.43
168 0.48
169 0.49
170 0.47
171 0.46
172 0.42
173 0.37
174 0.34
175 0.27
176 0.23
177 0.27
178 0.29
179 0.28
180 0.26
181 0.27
182 0.3
183 0.32
184 0.38
185 0.37
186 0.36
187 0.4
188 0.49
189 0.51
190 0.48
191 0.47
192 0.4
193 0.33
194 0.33
195 0.28
196 0.22
197 0.19
198 0.18
199 0.18
200 0.2
201 0.19
202 0.16
203 0.14
204 0.12
205 0.11
206 0.11
207 0.13
208 0.1
209 0.13
210 0.13
211 0.17
212 0.16
213 0.21
214 0.21
215 0.18
216 0.2
217 0.19
218 0.21
219 0.18
220 0.18
221 0.13
222 0.13
223 0.13
224 0.11
225 0.1
226 0.06
227 0.06
228 0.07
229 0.06
230 0.06
231 0.06
232 0.06
233 0.06
234 0.06
235 0.08
236 0.09
237 0.1
238 0.13
239 0.12
240 0.17
241 0.19
242 0.2
243 0.23
244 0.28
245 0.31
246 0.3
247 0.35
248 0.33
249 0.33
250 0.33
251 0.31
252 0.25
253 0.21
254 0.2
255 0.15
256 0.14
257 0.13
258 0.12
259 0.09
260 0.09
261 0.08
262 0.08
263 0.09
264 0.09
265 0.08
266 0.09
267 0.09
268 0.09
269 0.1
270 0.1
271 0.11
272 0.1
273 0.12
274 0.11
275 0.11
276 0.13
277 0.14
278 0.18
279 0.19
280 0.19
281 0.18
282 0.18
283 0.19
284 0.17
285 0.15
286 0.11
287 0.11
288 0.09
289 0.08
290 0.08
291 0.09
292 0.09
293 0.09
294 0.09
295 0.08
296 0.08
297 0.08
298 0.07
299 0.08
300 0.1
301 0.1
302 0.11
303 0.11
304 0.11
305 0.1
306 0.1
307 0.09
308 0.07
309 0.06
310 0.05
311 0.06
312 0.07
313 0.07
314 0.07
315 0.08
316 0.09
317 0.09
318 0.11
319 0.1
320 0.09
321 0.12
322 0.14
323 0.19
324 0.24
325 0.27
326 0.27
327 0.29
328 0.3
329 0.29
330 0.27
331 0.23
332 0.2
333 0.16
334 0.16
335 0.15
336 0.17
337 0.15
338 0.15
339 0.17
340 0.2
341 0.2
342 0.22
343 0.2
344 0.22
345 0.22
346 0.24
347 0.23
348 0.24
349 0.25
350 0.23
351 0.24
352 0.22
353 0.24
354 0.22
355 0.2
356 0.14
357 0.13
358 0.13
359 0.15
360 0.14
361 0.12
362 0.11
363 0.11
364 0.11
365 0.11
366 0.1
367 0.07
368 0.07
369 0.08
370 0.08
371 0.09
372 0.09
373 0.09
374 0.09
375 0.09
376 0.09
377 0.07
378 0.07
379 0.07
380 0.06
381 0.06
382 0.08
383 0.08
384 0.08
385 0.08
386 0.08
387 0.1
388 0.12
389 0.14
390 0.13
391 0.13
392 0.18
393 0.19
394 0.21
395 0.24
396 0.25
397 0.24
398 0.25
399 0.25
400 0.21
401 0.21
402 0.22
403 0.21
404 0.21
405 0.2
406 0.23
407 0.22
408 0.22
409 0.24
410 0.2
411 0.18
412 0.2
413 0.23
414 0.2
415 0.23
416 0.28
417 0.3
418 0.32
419 0.32
420 0.3
421 0.27
422 0.3
423 0.28
424 0.29
425 0.29
426 0.33
427 0.34
428 0.34
429 0.34
430 0.32
431 0.31
432 0.24
433 0.23
434 0.19
435 0.21
436 0.23
437 0.22
438 0.21
439 0.24
440 0.23
441 0.22
442 0.2
443 0.15
444 0.11
445 0.11
446 0.15
447 0.13
448 0.16
449 0.18
450 0.19
451 0.21
452 0.24
453 0.25
454 0.21
455 0.23
456 0.22
457 0.19
458 0.17
459 0.15
460 0.12
461 0.13
462 0.14
463 0.13
464 0.12
465 0.13
466 0.13
467 0.14
468 0.17
469 0.17
470 0.17
471 0.15
472 0.17
473 0.17
474 0.18
475 0.16
476 0.14
477 0.13
478 0.13
479 0.14
480 0.13
481 0.16
482 0.17
483 0.18
484 0.18
485 0.18
486 0.19
487 0.21
488 0.23
489 0.25
490 0.26
491 0.26
492 0.29
493 0.28
494 0.27
495 0.24
496 0.22
497 0.22
498 0.2
499 0.22
500 0.2
501 0.2
502 0.21
503 0.24
504 0.23
505 0.19
506 0.19
507 0.2
508 0.21
509 0.22
510 0.21
511 0.17
512 0.15
513 0.15
514 0.14
515 0.14
516 0.13
517 0.12
518 0.12
519 0.12
520 0.14
521 0.15
522 0.15
523 0.13
524 0.13
525 0.15
526 0.15
527 0.15
528 0.14
529 0.12
530 0.12