Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6A6Y8H9

Protein Details
Accession A0A6A6Y8H9    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
18-43TAAPMRPHSQPRRRRSESRRHAQSECHydrophilic
NLS Segment(s)
PositionSequence
25-36HSQPRRRRSESR
Subcellular Location(s) nucl 17, cyto_nucl 11, mito 7
Family & Domain DBs
Amino Acid Sequences MPRPHRTHQRLPPLRPETAAPMRPHSQPRRRRSESRRHAQSECRPEAASAPYPAPAPSGGKENEPLTHPHLTLPTHSTFTSHSSTLPTPRSPPLFTTKKTQPRHMSPCHGTSRHRPQLPSASHRIPPPTAVDASWQCVTAAVLAQRAVKYAVVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.61
3 0.54
4 0.51
5 0.5
6 0.51
7 0.43
8 0.43
9 0.45
10 0.49
11 0.57
12 0.58
13 0.6
14 0.63
15 0.7
16 0.75
17 0.79
18 0.84
19 0.84
20 0.85
21 0.86
22 0.87
23 0.87
24 0.82
25 0.79
26 0.77
27 0.77
28 0.75
29 0.67
30 0.59
31 0.49
32 0.44
33 0.42
34 0.37
35 0.3
36 0.22
37 0.19
38 0.18
39 0.18
40 0.17
41 0.16
42 0.12
43 0.11
44 0.1
45 0.15
46 0.14
47 0.15
48 0.17
49 0.17
50 0.18
51 0.17
52 0.19
53 0.18
54 0.19
55 0.19
56 0.17
57 0.18
58 0.18
59 0.18
60 0.19
61 0.16
62 0.16
63 0.15
64 0.15
65 0.14
66 0.17
67 0.18
68 0.15
69 0.14
70 0.15
71 0.16
72 0.2
73 0.22
74 0.19
75 0.2
76 0.23
77 0.26
78 0.24
79 0.26
80 0.3
81 0.33
82 0.34
83 0.38
84 0.44
85 0.51
86 0.54
87 0.6
88 0.6
89 0.64
90 0.71
91 0.7
92 0.69
93 0.63
94 0.65
95 0.64
96 0.59
97 0.54
98 0.55
99 0.6
100 0.6
101 0.6
102 0.54
103 0.53
104 0.59
105 0.61
106 0.58
107 0.55
108 0.5
109 0.5
110 0.52
111 0.5
112 0.41
113 0.37
114 0.34
115 0.31
116 0.27
117 0.24
118 0.28
119 0.26
120 0.29
121 0.28
122 0.24
123 0.2
124 0.19
125 0.19
126 0.14
127 0.15
128 0.12
129 0.13
130 0.14
131 0.18
132 0.17
133 0.18
134 0.18