Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6A6Y3B3

Protein Details
Accession A0A6A6Y3B3    Localization Confidence High Confidence Score 19.2
NoLS Segment(s)
PositionSequenceProtein Nature
293-322SKDREHLIERRRKKASQKERKNMPVNRRGVBasic
NLS Segment(s)
PositionSequence
82-86RKRKR
256-320EHRKKEKELVKDGKKPFFLKKSEQKKLALVDRFAKMKSKDREHLIERRRKKASQKERKNMPVNRR
Subcellular Location(s) nucl 24, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009292  RRP36  
Gene Ontology GO:0005730  C:nucleolus  
GO:1990904  C:ribonucleoprotein complex  
GO:0000469  P:cleavage involved in rRNA processing  
Pfam View protein in Pfam  
PF06102  RRP36  
Amino Acid Sequences MVLQKTLNRSLRAQDDDSDDEQYLGASGGSSPSVLDTGDGDDINIASSESEDEDPKAKLSTVPFGIVAKAQDEILKQGGGSRKRKRGSDAEGQSSQLQALRERLRELKAQKSNSKAHPTQQSKSSREKKEDSEDSDSDSSSSDQPIHARSSKHAPATQSSKRTVTRNRQVVEVKKPVPRDPRFDPLTGPSPDDSKFKKRYGFLDEYKASEMAEMRAKIKKTKDAVEKEQLKRDLLAMENQQKAQESKEQRQKIVSEHRKKEKELVKDGKKPFFLKKSEQKKLALVDRFAKMKSKDREHLIERRRKKASQKERKNMPVNRRGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.44
3 0.46
4 0.45
5 0.41
6 0.34
7 0.28
8 0.25
9 0.21
10 0.15
11 0.1
12 0.08
13 0.05
14 0.05
15 0.06
16 0.06
17 0.06
18 0.06
19 0.06
20 0.07
21 0.07
22 0.07
23 0.07
24 0.09
25 0.11
26 0.1
27 0.1
28 0.1
29 0.1
30 0.1
31 0.09
32 0.07
33 0.05
34 0.05
35 0.06
36 0.08
37 0.1
38 0.1
39 0.12
40 0.14
41 0.15
42 0.16
43 0.16
44 0.14
45 0.16
46 0.17
47 0.22
48 0.21
49 0.22
50 0.22
51 0.21
52 0.22
53 0.2
54 0.18
55 0.12
56 0.11
57 0.1
58 0.11
59 0.11
60 0.13
61 0.12
62 0.12
63 0.11
64 0.15
65 0.21
66 0.28
67 0.37
68 0.44
69 0.52
70 0.57
71 0.6
72 0.62
73 0.64
74 0.63
75 0.63
76 0.61
77 0.59
78 0.55
79 0.54
80 0.48
81 0.39
82 0.32
83 0.24
84 0.18
85 0.13
86 0.19
87 0.22
88 0.22
89 0.25
90 0.28
91 0.29
92 0.34
93 0.37
94 0.4
95 0.43
96 0.48
97 0.5
98 0.53
99 0.57
100 0.58
101 0.62
102 0.54
103 0.53
104 0.57
105 0.58
106 0.54
107 0.56
108 0.58
109 0.54
110 0.62
111 0.66
112 0.61
113 0.62
114 0.63
115 0.59
116 0.6
117 0.6
118 0.55
119 0.52
120 0.46
121 0.44
122 0.41
123 0.35
124 0.27
125 0.22
126 0.18
127 0.12
128 0.12
129 0.08
130 0.09
131 0.1
132 0.12
133 0.15
134 0.17
135 0.17
136 0.18
137 0.25
138 0.28
139 0.3
140 0.3
141 0.28
142 0.29
143 0.36
144 0.39
145 0.36
146 0.35
147 0.36
148 0.36
149 0.41
150 0.45
151 0.47
152 0.51
153 0.54
154 0.52
155 0.53
156 0.56
157 0.55
158 0.54
159 0.51
160 0.46
161 0.43
162 0.44
163 0.45
164 0.5
165 0.48
166 0.47
167 0.45
168 0.49
169 0.49
170 0.47
171 0.42
172 0.36
173 0.39
174 0.33
175 0.3
176 0.22
177 0.21
178 0.22
179 0.25
180 0.26
181 0.28
182 0.33
183 0.35
184 0.4
185 0.41
186 0.44
187 0.48
188 0.52
189 0.46
190 0.49
191 0.46
192 0.43
193 0.42
194 0.37
195 0.28
196 0.21
197 0.19
198 0.12
199 0.16
200 0.15
201 0.16
202 0.2
203 0.22
204 0.26
205 0.3
206 0.35
207 0.35
208 0.42
209 0.49
210 0.53
211 0.59
212 0.63
213 0.69
214 0.66
215 0.69
216 0.63
217 0.54
218 0.47
219 0.41
220 0.34
221 0.26
222 0.26
223 0.26
224 0.31
225 0.32
226 0.32
227 0.32
228 0.31
229 0.3
230 0.28
231 0.3
232 0.3
233 0.37
234 0.47
235 0.51
236 0.51
237 0.54
238 0.54
239 0.53
240 0.57
241 0.58
242 0.59
243 0.64
244 0.72
245 0.73
246 0.74
247 0.75
248 0.71
249 0.69
250 0.69
251 0.7
252 0.69
253 0.73
254 0.78
255 0.75
256 0.74
257 0.69
258 0.67
259 0.65
260 0.62
261 0.62
262 0.66
263 0.7
264 0.74
265 0.75
266 0.7
267 0.67
268 0.68
269 0.67
270 0.62
271 0.56
272 0.52
273 0.51
274 0.51
275 0.47
276 0.47
277 0.43
278 0.46
279 0.51
280 0.54
281 0.57
282 0.62
283 0.69
284 0.69
285 0.74
286 0.75
287 0.76
288 0.76
289 0.78
290 0.77
291 0.76
292 0.79
293 0.8
294 0.81
295 0.82
296 0.85
297 0.86
298 0.9
299 0.93
300 0.93
301 0.9
302 0.9